DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and DIP-kappa

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_723828.1 Gene:DIP-kappa / 318958 FlyBaseID:FBgn0051814 Length:672 Species:Drosophila melanogaster


Alignment Length:401 Identity:184/401 - (45%)
Similarity:261/401 - (65%) Gaps:26/401 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LAEMQNKDELLEDIREDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRV 166
            |||:.:|.   :..|.||...|..:.|.|:|.|.:.||||.|.|:|::.|||:||:.||:||:||
  Fly    49 LAEIPSKG---KHTRLDTQQTAQEDSDFPRFAEPIANVTVSVGRDALMACVVENLKGYKVAWVRV 110

  Fly   167 DTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP 231
            ||||||:|.::||::|.|:|:|:.:.|:|.|.|::|:|:|:||||||:|||||:|:.|||.||||
  Fly   111 DTQTILSIHHNVISQNSRISLTYNDHRSWYLHIKEVEETDRGWYMCQVNTDPMRSRKGYLQVVVP 175

  Fly   232 PDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKV 296
            |.|::..||.|||:|||.|::|.|.|.|.|.|.:.||||.||.: |..|......:|..|.|.||
  Fly   176 PIIVEGLTSNDMVVREGQNISLVCKARGYPEPYVMWRREDGEEM-LIGGEHVNVVDGELLHITKV 239

  Fly   297 NRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYW 361
            :||:|.||||:||||:||::||||.|.|.||||:.|.|||.||.|.|::.|||.:||||.|||||
  Fly   240 SRLHMAAYLCVASNGVPPSISKRVHLRVQFPPMLSIPNQLEGAYLGQDVILECHTEAYPASINYW 304

  Fly   362 M--KNDTIIV----PGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLY 420
            .  :.|.||.    .|:::...:..|||...|:|.|..|...|||.||||||||||:|||.|||.
  Fly   305 TTERGDMIISDTSRAGDKYETTSTVSGYTKYMKLKIRAVGPNDFGTYRCVAKNSLGETDGNIKLD 369

  Fly   421 HIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSK 485
            .:|..|       |..|:.:.::...|:.::|:.:         .|:..|:..:..::..:..::
  Fly   370 EMPTPT-------TAIISEMSLLNRSYDGKRRHRN---------KFDSANALPDYGVEEWRDGAQ 418

  Fly   486 GSDQSPSGLNN 496
            |::...:|.||
  Fly   419 GNNAGNNGDNN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 54/92 (59%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 4/4 (100%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 48/91 (53%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 4/4 (100%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 42/86 (49%)
DIP-kappaNP_723828.1 IG_like 82..174 CDD:214653 54/91 (59%)
Ig strand B 91..95 CDD:409353 1/3 (33%)
Ig strand C 104..108 CDD:409353 2/3 (67%)
Ig strand E 139..143 CDD:409353 2/3 (67%)
Ig strand F 153..158 CDD:409353 4/4 (100%)
Ig strand G 165..168 CDD:409353 1/2 (50%)
Ig 176..267 CDD:472250 48/91 (53%)
Ig strand B 195..199 CDD:409301 1/3 (33%)
Ig strand C 208..212 CDD:409301 0/3 (0%)
Ig strand E 232..236 CDD:409301 1/3 (33%)
Ig strand F 246..251 CDD:409301 4/4 (100%)
Ig strand G 260..263 CDD:409301 2/2 (100%)
IG_like 282..368 CDD:214653 43/85 (51%)
Ig strand B 288..292 CDD:409353 1/3 (33%)
Ig strand C 301..305 CDD:409353 3/3 (100%)
Ig strand E 330..340 CDD:409353 5/9 (56%)
Ig strand F 350..355 CDD:409353 3/4 (75%)
Ig strand G 363..366 CDD:409353 2/2 (100%)

Return to query results.
Submit another query.