DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr14

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:240 Identity:70/240 - (29%)
Similarity:106/240 - (44%) Gaps:40/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 KDELLEDIREDTVVNAIPEKDLPKFGE--LLQNVTVPVSREAVLQCVVDNLQTYKIAWL--RVDT 168
            :||.||      |......:..|.|.:  ...|::..:|....|.|.|::||...::|:  |.|.
  Fly    57 EDEELE------VTETTTHEPFPFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDD 115

  Fly   169 QTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-P 232
            .|::|...|..:.:.|.|:...|...|.|.|:...|.|:|.|.||:::.|....:.||.::|| .
  Fly   116 LTLITFGQHTYSGDSRYSLEFEEPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHV 180

  Fly   233 DILDYPTST--DMVIREGSNVTLKCAATGSPTPT--ITWRR----------EGGELIP---LPNG 280
            :|||...|.  :...:.||.:.|:|..:..|.|:  ||||.          .||..:.   ||..
  Fly   181 EILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR 245

  Fly   281 AEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVH 325
            |.:..|      ||..||.:.|.|.|:..|.|..||      :||
  Fly   246 ALSRLY------IANANRQDTGNYTCMLGNEITETV------VVH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 28/94 (30%)
IG_like 137..230 CDD:214653 28/94 (30%)
IG_like 240..324 CDD:214653 28/100 (28%)
IGc2 247..310 CDD:197706 23/77 (30%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 25/79 (32%)
Ig 84..169 CDD:299845 25/84 (30%)
IG_like 191..279 CDD:214653 29/100 (29%)
Ig 201..274 CDD:143165 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.