DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Ncam2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:681 Identity:142/681 - (20%)
Similarity:234/681 - (34%) Gaps:163/681 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RRQRRRAAGKLQRKREMPEISSRLIVATATAAV-------VSIICLSLALPGCAAQESDDEGELH 75
            |.|...|.|:.|....:.||..:|......:..       ..::|...:.|..|.      ..|:
  Rat    92 RCQATDAKGQTQEATVVLEIYQKLTFREVLSPQEFKQGEDAEVVCRVSSSPAPAV------SWLY 150

  Fly    76 HLDQM------------HHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAIPEKD 128
            |.:::            ::..|...|.:|:|..:......|.:.:.:..:.|   .:||..|...
  Rat   151 HNEEVTTIPDNRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDII---VIVNVPPAIV 212

  Fly   129 LPK--FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAE 191
            :|:  |     |.|.....|..|.|.........|:|.|         ...:|.:|.:..:..:.
  Rat   213 MPQKSF-----NATAERGEEMTLTCKASGSPDPAISWFR---------NGKLIEENEKYILKGSN 263

  Fly   192 KRAWILRIRDVKESDKGWYMCQINTDPMKSQ-VGYLDVVVPPDILDYPTSTDMVIREGSNVTLKC 255
            ..   |.:|::...|.|.|:|:......:.| ..:|.|.|.|.||.....|   ..|..:|||.|
  Rat   264 TE---LTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNET---TSENGHVTLIC 322

  Fly   256 AATGSPTPTITWRR--------EGGELIPLPNG-AEAVAYNG-SFLTIAKVNRLNMGAYLCIASN 310
            .|.|.|.|.|||:|        ||.:   .|:| .|....:| |.|.|..|...:.|.|.|.|::
  Rat   323 EAEGEPVPEITWKRAIDGVTFSEGDK---SPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAAS 384

  Fly   311 GIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQN-ITLECQSEAYPKSINYWMKNDTIIVPGERF 374
            .|... .:.:.|.:.:.|. ::.||.:..:...| |.:.|..:|.|.:..:| :.:.:::|.:..
  Rat   385 RIGGH-QRSMHLDIEYAPK-FVSNQTMYYSWEGNPINISCDVKANPPASIHW-RREKLVLPAKNT 446

  Fly   375 VP-ETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLG--------------DTDGAIKLYHIPQ 424
            .. :|...|.|  |.|.|......|||.|.|.|.|.:|              .:...:|:..:.|
  Rat   447 THLKTHSVGRK--MILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPRGVKIIELSQ 509

  Fly   425 TTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNT-KLQRGKSNSKG-- 486
            ||..                :.:||.:.:|...   .:.|..:.......| |:.|    |.|  
  Rat   510 TTAK----------------ISFNKPESHGGVP---IHHYQVDVKEVTSETWKIVR----SHGVQ 551

  Fly   487 -----SDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHGSDHG 546
                 |...|:....|.|.|.    |.:.....|......:...|:......|.|..........
  Rat   552 TTVVLSSLEPNTTYEVRVAAV----NGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKIS 612

  Fly   547 ASYRSDGKSP---HLTNHDAKSLTDD--------------LDRMQDLKGW------ASRLSPISP 588
            .:.:.||.:|   ::..:.:|...|.              |:.:|...|:      |:||....|
  Rat   613 ITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEP 677

  Fly   589 I--------------------LGLSMILGVG 599
            .                    |||..|:|:|
  Rat   678 TVYEFSMPPKPNIIKDTLFNGLGLGAIIGLG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 19/93 (20%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/3 (33%)
Ig 232..324 CDD:472250 33/101 (33%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 22/82 (27%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452 7/20 (35%)
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452 2/3 (67%)
Ig strand G 101..112 CDD:409452 2/10 (20%)
Ig 117..193 CDD:472250 10/81 (12%)
Ig strand B 132..136 CDD:409353 0/3 (0%)
Ig strand C 145..152 CDD:409353 2/12 (17%)
Ig strand E 169..173 CDD:409353 0/3 (0%)
Ig strand F 183..187 CDD:409353 0/3 (0%)
Ig strand G 191..194 CDD:409353 1/2 (50%)
IgI_1_MuSK 209..298 CDD:409562 21/105 (20%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 2/9 (22%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 2/4 (50%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 1/8 (13%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 34/103 (33%)
Ig strand B 318..322 CDD:409353 3/3 (100%)
Ig strand C 331..335 CDD:409353 2/3 (67%)
Ig strand E 363..367 CDD:409353 2/3 (67%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 22/81 (27%)
FN3 496..588 CDD:238020 20/118 (17%)
fn3 594..678 CDD:394996 13/83 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.