DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and PRTG

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_776175.2 Gene:PRTG / 283659 HGNCID:26373 Length:1150 Species:Homo sapiens


Alignment Length:510 Identity:109/510 - (21%)
Similarity:184/510 - (36%) Gaps:138/510 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNA---IPEKD----------------LP 130
            :|.::.:.:.|..:...:..::|..::.|:.|.:.:.|.   |.|.:                :.
Human    53 KDPVVLDCQAHGEVPIKVTWLKNGAKMSENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMN 117

  Fly   131 KFGELLQN------VTV------PVSRE------AVLQCVVDNLQTYKIAW--------LRVDTQ 169
            |:|.:|..      .|:      |:|.|      |...|.:.:.....|.|        :.:|..
Human   118 KYGAILSQKAHLALSTISAFEVQPISTEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDRI 182

  Fly   170 TILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINT--DPMKSQVGYLDVVVPP 232
            |.|.                    ..:|:|.||.:.|.|.|.|...|  ...||....|.|:...
Human   183 TALP--------------------TGVLQIYDVSQRDSGNYRCIAATVAHRRKSMEASLTVIPAK 227

  Fly   233 DILDYPTSTDMVIREGSNVT--------LKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGS 289
            :...:.|.|  :|....|:|        |:|.|||:|.|.|:|.|...:.|.:.|  ..|..||:
Human   228 ESKSFHTPT--IIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFN--TRVLGNGN 288

  Fly   290 FLTIAKVNRLNMGAYLCIASNGIPP-----TVSKRVMLIVHFPPMI-WIQNQLVGAALTQNITLE 348
             |.|:.|...:.|.|:|.|:.   |     ||:...:.::..|..: |.::.....|.|....  
Human   289 -LMISDVRLQHAGVYVCRATT---PGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFV-- 347

  Fly   349 CQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITM---RLTIYEVDIQDFGAYRCVAKNSL 410
            ||:|..|.....|:||...|           .|..:|.|   :|.|.::..:|...|:|:|:||.
Human   348 CQAEGIPSPKMSWLKNGRKI-----------HSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQ 401

  Fly   411 GDTDGAIKLYHIPQTTTMTTMAPTVSIN------TVPVVLVK-----YNKEQ------RYGSSQN 458
            |......:|     |..|:...|:...|      :...:|:.     ||.::      .|..::.
Human   402 GSILSRARL-----TVVMSEDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEG 461

  Fly   459 SNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQ--DH 511
            .|...|....||...:..:         .|..|:.....::.|...:..||  ||
Human   462 LNNEEYQVVIGNDTTHYII---------DDLEPASNYTFYIVAYMPMGASQMSDH 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 24/120 (20%)
IG_like 137..230 CDD:214653 24/120 (20%)
IG_like 240..324 CDD:214653 29/96 (30%)
IGc2 247..310 CDD:197706 24/70 (34%)
Ig 327..419 CDD:299845 24/95 (25%)
IG_like 343..420 CDD:214653 20/79 (25%)
PRTGNP_776175.2 Ig 40..130 CDD:299845 11/76 (14%)
Ig 139..223 CDD:299845 22/103 (21%)
IG_like 141..223 CDD:214653 22/101 (22%)
IG_like 241..323 CDD:214653 27/87 (31%)
IGc2 250..309 CDD:197706 22/64 (34%)
I-set 327..412 CDD:254352 25/102 (25%)
Ig 345..412 CDD:299845 21/84 (25%)
FN3 419..512 CDD:238020 17/98 (17%)
FN3 517..610 CDD:238020
fn3 624..699 CDD:278470
FN3 726..814 CDD:238020
FN3 821..911 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1150
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.