DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr7

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:236 Identity:54/236 - (22%)
Similarity:95/236 - (40%) Gaps:46/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 VNAIPEKDLPKFGELL-QNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHR 184
            :|.:...:.|.|.::. :||:..|...|:|:|.|.|.....::|:|.....|||...:..|.:.|
  Fly    42 LNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQR 106

  Fly   185 MSITHAE-KRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPT--------- 239
            .|:.|.. ...|.|:|...:..|.|.|.||:||:|..:....|.|:...|..|..|         
  Fly   107 FSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKS 171

  Fly   240 -------STDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNG--------- 288
                   ||::.::..|.:.|.| :.....|::.|.          :|:..|.::.         
  Fly   172 ARAKILGSTEIHVKRDSTIALAC-SVNIHAPSVIWY----------HGSSVVDFDSLRGGISLET 225

  Fly   289 --------SFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVM 321
                    |.|.:.:.:..:.|.|.|:.:..||.:|...|:
  Fly   226 EKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 30/93 (32%)
IG_like 137..230 CDD:214653 30/93 (32%)
IG_like 240..324 CDD:214653 18/99 (18%)
IGc2 247..310 CDD:197706 12/79 (15%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
dpr7NP_001096850.2 V-set 56..145 CDD:284989 28/88 (32%)
IG_like 58..140 CDD:214653 26/81 (32%)
IG_like 179..265 CDD:214653 17/96 (18%)
Ig 187..257 CDD:299845 12/80 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.