DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:345 Identity:82/345 - (23%)
Similarity:130/345 - (37%) Gaps:93/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PEKDLPKFG-ELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSIT 188
            |...||.|. ::.:|:||.|.:...|.|.|:.|....::|:|.....|||......|.:.|..:.
  Fly    48 PSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL 112

  Fly   189 HAEKRA-WILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVV-VPPDILDYPTSTDMVIREGSNV 251
            ..:..| |.|:|:..:..|.|.|.|||||:|..|.....:|| :..:|..   .:|::::.||::
  Fly   113 RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDI 174

  Fly   252 TLKCAATGSP--TPTITWRREGGELIPLPNGAEAVAYNGSFLTI-------------AKVNRL-- 299
            .|.|.....|  ...|.|.: |.|::   :|......:.|...|             .|:.|.  
  Fly   175 NLTCKIMQGPHELGNIFWYK-GSEML---DGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP 235

  Fly   300 -NMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVG---AALTQNITLECQSEAYPKSINY 360
             :.|.|.|:      |||:|...:.||.         ::|   ||:..|.:....|         
  Fly   236 GDTGNYTCV------PTVAKTSSVYVHV---------IIGEHPAAMQHNSSSNSNS--------- 276

  Fly   361 WMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRC--------VAKNS-LGDTDGA 416
                              |..|. ..|.|:|....:|.|....|        :||:: ||.    
  Fly   277 ------------------FYCGI-CCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGP---- 318

  Fly   417 IKLYHIPQTTTMTTMAPTVS 436
                  |:..|:||....:|
  Fly   319 ------PKRATLTTSETGIS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 31/94 (33%)
IG_like 137..230 CDD:214653 31/94 (33%)
IG_like 240..324 CDD:214653 22/101 (22%)
IGc2 247..310 CDD:197706 17/80 (21%)
Ig 327..419 CDD:299845 17/103 (17%)
IG_like 343..420 CDD:214653 14/85 (16%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/94 (31%)
IG_like 60..150 CDD:214653 29/89 (33%)
IG_like 163..257 CDD:214653 23/103 (22%)
Ig 174..244 CDD:143165 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.