DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and dpr9

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:232 Identity:69/232 - (29%)
Similarity:101/232 - (43%) Gaps:36/232 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LEDIREDTVVNAIP--EKDLPKFGELLQNVTVPVSREAVLQCVVDNL----QTYKIAWLRVDTQT 170
            ||:.|     ||.|  :|...|      |||..:.:.|.|.|.|.||    ...:::|:|.....
  Fly   248 LEEAR-----NAGPYFDKAFSK------NVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIH 301

  Fly   171 ILTIQNHVITKNHRMSITH-AEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVP-PD 233
            :||:..:..|.:.|....| .:...|:|:|:..:..|.|.|.||::|.|..|...:|:||.| .:
  Fly   302 LLTVGRYTYTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTE 366

  Fly   234 ILDYPTSTDMVIREGSNVTLKCAATGSPTPT--ITWRREGG-----ELI--PLPNGAEAVAYN-- 287
            |:..|   |:.|..||.:.|.|....||.|.  |.|.....     ::|  ..|.|..:|..|  
  Fly   367 IIGAP---DLYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKG 428

  Fly   288 ---GSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVM 321
               .|||.|......:.|.|.|..||..|.:|:..|:
  Fly   429 DTTTSFLLIKSARPSDSGHYQCNPSNAKPKSVTVHVL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 29/97 (30%)
IG_like 137..230 CDD:214653 29/97 (30%)
IG_like 240..324 CDD:214653 28/96 (29%)
IGc2 247..310 CDD:197706 21/76 (28%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
dpr9NP_001287332.1 Ig 263..361 CDD:299845 29/103 (28%)
IG_like 263..360 CDD:214653 29/102 (28%)
IG_like 371..464 CDD:214653 28/95 (29%)
IGc2 377..456 CDD:197706 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.