DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and MDGA1

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens


Alignment Length:328 Identity:82/328 - (25%)
Similarity:135/328 - (41%) Gaps:51/328 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWIL 197
            |...|..||      .|:|.|::....:..|.| .:.|:...|::.: ..:....|..|.:  :|
Human   145 GNFYQEKTV------FLRCTVNSNPPARFIWKR-GSDTLSHSQDNGV-DIYEPLYTQGETK--VL 199

  Fly   198 RIRDVKESDKGWYMCQINTD-----PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAA 257
            ::::::..|...|.||::..     |.|:....|.....|..|....:..:|:..|.|||::|..
Human   200 KLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPPALKLSVNETLVVNPGENVTVQCLL 264

  Fly   258 T-GSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVM 321
            | |.|.|.:.|....|   |||.||.|   .|..|:|..|...:.|.|.|.|:|.:.....|.|.
Human   265 TGGDPLPQLQWSHGPG---PLPLGALA---QGGTLSIPSVQARDSGYYNCTATNNVGNPAKKTVN 323

  Fly   322 LIVH---------FPPMIWIQNQLVGAALTQNITLECQSEAYP-KSINY-WMKNDTIIVPGERFV 375
            |:|.         .|.:|   .:.....|.|::.|.|..:|.| :.:.| |.||.......:|.:
Human   324 LLVRSMKNATFQITPDVI---KESENIQLGQDLKLSCHVDAVPQEKVTYQWFKNGKPARMSKRLL 385

  Fly   376 -----PETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGA-IKLYHIPQTTTMTTMAPT 434
                 ||.    ..:|..|.:.::...|:|.|.|:|     ...|| :....:....:..|:.||
Human   386 VTRNDPEL----PAVTSSLELIDLHFSDYGTYLCMA-----SFPGAPVPDLSVEVNISSETVPPT 441

  Fly   435 VSI 437
            :|:
Human   442 ISV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 20/97 (21%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 32/92 (35%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 22/87 (25%)
MDGA1XP_006715119.1 Ig 44..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
IG_like 152..217 CDD:214653 16/74 (22%)
Ig strand B 153..157 CDD:409353 2/9 (22%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 197..201 CDD:409353 1/5 (20%)
Ig strand F 211..216 CDD:409353 2/4 (50%)
IG_like 248..326 CDD:214653 30/83 (36%)
Ig strand B 258..262 CDD:409412 2/3 (67%)
Ig strand C 272..276 CDD:409412 0/3 (0%)
Ig strand E 291..295 CDD:409412 1/3 (33%)
Ig strand F 305..310 CDD:409412 2/4 (50%)
Ig 334..418 CDD:472250 22/95 (23%)
Ig strand B 353..357 CDD:409353 1/3 (33%)
Ig strand C 368..372 CDD:409353 1/3 (33%)
Ig strand E 398..402 CDD:409353 1/3 (33%)
Ig strand F 412..417 CDD:409353 2/4 (50%)
Ig_3 439..515 CDD:464046 3/6 (50%)
Ig_3 538..619 CDD:464046
MAM 753..916 CDD:99706
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.