DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and DIP-lambda

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:514 Identity:159/514 - (30%)
Similarity:228/514 - (44%) Gaps:128/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TATAAVVSIICLSLALPGCAAQESDDEGELHHLDQMHHQHQDFIIGESEEHDHIAHHLAEMQNKD 109
            |...::..|:..::.:..|           |.:..:|.:      |||||.|             
  Fly    15 TLACSIAFILIKAITITKC-----------HAVAHIHGK------GESEEID------------- 49

  Fly   110 ELLEDIREDTVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTI 174
                                |:|...|.|.|||:.|:....||||||..|::||::.|::.||.|
  Fly    50 --------------------PQFLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGI 94

  Fly   175 QNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYP- 238
            ..|:::.|.|:|:||.....|.|.|..|:.:|.|.||||:|||||||..||||||||||||::| 
  Fly    95 HTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPE 159

  Fly   239 -TSTDMVIREGSNVTLKCAATGSPTPTITWRREGG-ELIPLPNGAEAVAY---NGSFLTIAKVNR 298
             ...|.|.:||.:::|.|:.||.|.|.:.||||.| |:|...:|.:...:   .|..|.:..|.|
  Fly   160 HNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQR 224

  Fly   299 LNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMK 363
            .:||.|.|||||||||:||||..:.|:|.|.:...:|||||.:.:.:||||..|.:||.:|.|.:
  Fly   225 SDMGGYNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYR 289

  Fly   364 NDTIIV--PGERF-VPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQT 425
            ::..|.  .|.:: :.|...:.|...:.|||..:...|||.|.|.:.|:||.::..|:|..:...
  Fly   290 SEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLP 354

  Fly   426 TTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQS 490
            ..:|| .||..:.|.                                       |||..|.....
  Fly   355 PKLTT-TPTPHMQTT---------------------------------------GKSRRKHPASH 379

  Fly   491 PSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHGSDHGASY 549
            ..|||.|.                             ..|:.|...|.|....||...:
  Fly   380 KKGLNEVL-----------------------------RFQETHFANQIQQENEDHNEGF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 46/92 (50%)
Ig strand B 147..151 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 43/97 (44%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 27/83 (33%)
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 46/92 (50%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 2/3 (67%)
Ig strand F 129..134 CDD:409353 3/4 (75%)
Ig 153..250 CDD:472250 42/96 (44%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 2/2 (100%)
IG_like 271..349 CDD:214653 25/77 (32%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 1/3 (33%)
Ig strand E 308..320 CDD:409353 2/11 (18%)
Ig strand F 330..335 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.