DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Cadm4

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_694752.1 Gene:Cadm4 / 260299 MGIID:2449088 Length:388 Species:Mus musculus


Alignment Length:345 Identity:82/345 - (23%)
Similarity:126/345 - (36%) Gaps:60/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PKFGELLQ--NVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHV----------ITKN 182
            |..|:.:|  ||||.....|.:.|   .|..|        ..:|:.|||..          ..|:
Mouse    21 PGTGQEVQTENVTVAEGGVAEITC---RLHQY--------DGSIVVIQNPARQTLFFNGTRALKD 74

  Fly   183 HRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIR- 246
            .|..:.....|...:|:.|.:..|:|.|.||:.|:....|:..|.|:|.|:      :..:.:| 
Mouse    75 ERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPE------NPVVEVRE 133

  Fly   247 ---EGSNVTLKCAATGS-PTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNM------ 301
               ||..|.|.|....| |...:.|.|:..||..:.:|.|    ||...::|...|..:      
Mouse   134 QAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQE----NGKVWSVASTVRFRVDRKDDG 194

  Fly   302 GAYLCIASN-GIPPTVSKRV--MLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINY-WM 362
            |..:|.|.| .:|...||:.  :|.|.:.|...|............:.|.|.....|:.... |.
Mouse   195 GIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWN 259

  Fly   363 KNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDG--AIKLYHIPQT 425
            :       |...:||..|:   :...||:..:...|.|.|.|.|.|..|....  .:.:|.....
Mouse   260 R-------GNESLPERAEA---VGETLTLPGLVSADNGTYTCEAANKHGHARALYVLVVYDPGAV 314

  Fly   426 TTMTTMAPTVSINTVPVVLV 445
            ....|..|...:..:..:||
Mouse   315 VEAQTSVPYAIVGGILALLV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 27/104 (26%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 27/105 (26%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 0/3 (0%)
Ig strand F 303..308 CDD:409275 1/4 (25%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 17/81 (21%)
Cadm4NP_694752.1 Ig 29..120 CDD:472250 25/101 (25%)
Ig strand B 40..44 CDD:409465 1/3 (33%)
Ig strand C 53..57 CDD:409465 1/3 (33%)
Ig strand E 87..91 CDD:409465 0/3 (0%)
Ig strand F 101..106 CDD:409465 2/4 (50%)
Ig strand G 113..116 CDD:409465 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 28/108 (26%)
Ig strand A 121..124 CDD:409468 1/2 (50%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 2/8 (25%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 2/10 (20%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 17/80 (21%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.