DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Ntm

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:309 Identity:103/309 - (33%)
Similarity:161/309 - (52%) Gaps:33/309 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI 196
            |.:.:.||||.....|.|:|.:||..| ::|||  :..|||...|.....:.|:.:....:..:.
Mouse    38 FPKAMDNVTVRQGESATLRCTIDNRVT-RVAWL--NRSTILYAGNDKWCLDPRVVLLSNTQTQYS 99

  Fly   197 LRIRDVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATG 259
            :.|::|...|:|.|.|.:.||  |..|:| :|.|.|.|.|::  .|:|:.|.||:|::|.|.|||
Mouse   100 IEIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVSPKIVE--ISSDISINEGNNISLTCIATG 161

  Fly   260 SPTPTITWRREGGELIPLPNGAEAVAY--NGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVML 322
            .|.||:|||    .:.|     :||.:  ...:|.|..:.|...|.|.|.|||.:...|.:||.:
Mouse   162 RPEPTVTWR----HISP-----KAVGFVSEDEYLEIQGITREQSGEYECSASNDVAAPVVRRVKV 217

  Fly   323 IVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITM 387
            .|::||.| .:.:..|..:.|..||:|::.|.|.:...|.|:|..:|.|::        |.|:..
Mouse   218 TVNYPPYI-SEAKGTGVPVGQKGTLQCEASAVPSAEFQWFKDDKRLVEGKK--------GVKVEN 273

  Fly   388 R-----LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTM 431
            |     ||.:.|...|:|.|.|||.|.||.|:.:|.|:.:.:.|:.|.:
Mouse   274 RPFLSKLTFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 31/94 (33%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 34/93 (37%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 27/85 (32%)
NtmNP_001344522.1 Ig 44..132 CDD:472250 30/91 (33%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 136..205 CDD:464046 29/79 (37%)
Ig 223..307 CDD:472250 30/92 (33%)
Ig strand B 239..243 CDD:409353 2/3 (67%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 1/3 (33%)
Ig strand F 292..297 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.