DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Iglon5

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:351 Identity:99/351 - (28%)
Similarity:143/351 - (40%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAW 195
            :|.....|.||.....|.|.|.:|...| ::|||  :...||...|...|.:.|:.:.......:
Mouse    34 EFSSPADNYTVCEGDNATLSCFIDEHVT-RVAWL--NRSNILYAGNDRWTSDPRVRLLINTPEEF 95

  Fly   196 ILRIRDVKESDKGWYMCQINT--DPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAAT 258
            .:.|..|...|:|.|.|...|  .|..:|| ||.|.||..|::  .|:.:.:.||.||.|.|.|.
Mouse    96 SILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIVN--ISSPVAVNEGGNVNLLCLAV 157

  Fly   259 GSPTPTITWR--REGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTV-SKRV 320
            |.|.||:|||  |:|            ....|..|.|:.:.|...|.|.|:..||:.... |:||
Mouse   158 GRPEPTVTWRQLRDG------------FTSEGEILEISDIQRGQAGEYECVTHNGVNSAPDSRRV 210

  Fly   321 MLIVHFPPMIWIQNQLVGA--ALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGY 383
            ::.|::||.|   ..:..|  ||.:...|.|::.|.|.:...|.|:|.::..|.       ..|.
Mouse   211 LVTVNYPPTI---TDVTSARTALGRAALLRCEAMAVPPADFQWYKDDRLLSSGS-------AEGL 265

  Fly   384 KI-TMR----LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVV 443
            |: |.|    |....|..:.:|.|.|.|.|.||.:..:::|.                       
Mouse   266 KVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLL----------------------- 307

  Fly   444 LVKYNKEQRYGSSQNSNTNPYNFNPG 469
                    |.||.:||...|    ||
Mouse   308 --------RPGSLENSAPRP----PG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/94 (31%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 30/94 (32%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 24/87 (28%)
Iglon5NP_001157990.1 Ig 41..129 CDD:472250 28/91 (31%)
Ig strand B 50..54 CDD:409382 2/3 (67%)
Ig strand C 62..66 CDD:409382 1/3 (33%)
Ig strand E 95..99 CDD:409382 0/3 (0%)
Ig strand F 109..114 CDD:409382 2/4 (50%)
Ig strand G 122..125 CDD:409382 0/2 (0%)
Ig_3 134..199 CDD:464046 25/78 (32%)
Ig_3 217..295 CDD:464046 24/87 (28%)

Return to query results.
Submit another query.