DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and zig-3

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:267 Identity:62/267 - (23%)
Similarity:103/267 - (38%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNV 251
            ::..|.||.:..:  |:|.|.    ..:.|.|....:..|:              |..:..|.:|
 Worm    17 LSSGEMRAAVSNL--VREIDS----THLTTKPSLKIIEGLE--------------DNTVSTGESV 61

  Fly   252 TLKCAATGSPTPTITWRREGGEL---------IPLPNGAEAVAYNG---SFLTIAKVNRLNMGAY 304
            ||:|....:||..|.|.::|..:         ..:.|.......:|   |...|...|..::|:|
 Worm    62 TLRCDVLSTPTGVIYWEKDGQRIQGDKELNVFEKVLNAMGPTVESGIITSSYQIPCANLHHIGSY 126

  Fly   305 LCIASNGIPPTVSKRVMLIV-----------HFPPMIWIQNQLVGAALTQNITLECQSEAYPKSI 358
            .|:|:|| ..||.....:.|           ...|:|.:..:..........||.|:::   :..
 Worm   127 KCVATNG-HDTVESSAKISVEGQTVKCKSTRRSAPVITMSTESRFELQDNAATLICRAD---RRA 187

  Fly   359 NY-WMKNDTIIVPGERFVPETFESG-YKI--TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKL 419
            |: ||..|..|         .|:|| |::  :..|.|.::...|.|:|.|:|.|..|::.|...|
 Worm   188 NWNWMFEDKKI---------DFDSGRYELLPSGDLLIRKIQWSDMGSYFCIAHNKYGESRGETFL 243

  Fly   420 Y----HI 422
            |    ||
 Worm   244 YPTKKHI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 9/42 (21%)
IG_like 137..230 CDD:214653 9/42 (21%)
IG_like 240..324 CDD:214653 24/95 (25%)
IGc2 247..310 CDD:197706 19/74 (26%)
Ig 327..419 CDD:299845 24/95 (25%)
IG_like 343..420 CDD:214653 22/80 (28%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 25/114 (22%)
Ig 61..142 CDD:143165 22/81 (27%)
IG_like 177..244 CDD:214653 22/78 (28%)
Ig <191..237 CDD:299845 17/54 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.