DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Cntn3

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_032805.2 Gene:Cntn3 / 18488 MGIID:99534 Length:1028 Species:Mus musculus


Alignment Length:326 Identity:84/326 - (25%)
Similarity:141/326 - (43%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 VSREAVLQ-CVVDNLQTYKIAWLRV-DTQTILTI---------QNHVITKNHRMSITHAEKRAWI 196
            |||||.|| ..::|.:|...:.:.| :.|.::.:         .::....|...|....:.|.::
Mouse   110 VSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVFNEYPSFVEEDSRRFV 174

  Fly   197 ------LRIRDVKESDKGWYMCQINTDPMKSQV------------GYLDVVVPPDILDYPTSTDM 243
                  |.|..|:.||.|.|.|.:.:....::|            |.:....|...:.:|.:  :
Mouse   175 SQETGHLYIAKVEPSDVGNYTCVVTSTVTNTRVLGSPTPL
VLRSDGVMGEYEPKIEVQFPET--L 237

  Fly   244 VIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIA 308
            ...:||.|.|:|.|.|:|.|.|.|||..|  :|.||..:...:|| .|.|....:.:.|:|.|||
Mouse   238 PAAKGSTVRLECFALGNPVPQINWRRSDG--MPFPNKIKLRKFNG-MLEIQNFQQEDTGSYECIA 299

  Fly   309 SNGIPPTVSKRVMLIVHFPPMIWIQ-NQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGE 372
            .|.....|::.  .:.::....|:| .:.|..|:..::..||::...||....|:||...:|..|
Mouse   300 ENSRGKNVARG--RLTYY
AKPYWLQLLRDVEIAVEDSLYWECRASGKPKPSYRWLKNGDALVLEE 362

  Fly   373 RFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSI 437
            |.   ..|:|     .|||..:::.|.|.::|:|:|..|       |.:......:...||..|.
Mouse   363 RI---QIENG-----ALTITNLNVTDSGMFQCIAENKHG-------LIYSSAELKVVASAPDFSR 412

  Fly   438 N 438
            |
Mouse   413 N 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 24/115 (21%)
Ig strand B 147..151 CDD:409353 3/4 (75%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 1/9 (11%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/14 (7%)
Ig 232..324 CDD:472250 29/91 (32%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 23/81 (28%)
Cntn3NP_032805.2 Ig 25..120 CDD:472250 7/9 (78%)
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353 2/2 (100%)
Ig 129..214 CDD:472250 14/84 (17%)
Ig strand B 140..144 CDD:409353 0/3 (0%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 0/2 (0%)
Ig 227..315 CDD:472250 30/94 (32%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/4 (50%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 1/2 (50%)
Ig 320..403 CDD:472250 26/97 (27%)
Ig strand B 335..339 CDD:409353 0/3 (0%)
Ig strand C 348..352 CDD:409353 0/3 (0%)
Ig strand E 369..373 CDD:409353 2/8 (25%)
Ig strand F 383..388 CDD:409353 1/4 (25%)
Ig strand G 396..399 CDD:409353 0/2 (0%)
Ig 408..496 CDD:472250 3/6 (50%)
Ig strand B 427..431 CDD:409353
Ig strand C 440..444 CDD:409353
Ig strand E 462..466 CDD:409353
Ig strand F 476..481 CDD:409353
Ig strand G 489..492 CDD:409353
Ig 498..598 CDD:472250
Ig strand B 517..521 CDD:409353
Ig strand C 532..536 CDD:409353
Ig strand E 560..564 CDD:409353
Ig strand F 574..579 CDD:409353
FN3 579..>1006 CDD:442628
Ig strand G 587..590 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..714
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.