DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and zig-4

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:264 Identity:62/264 - (23%)
Similarity:103/264 - (39%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTL 253
            |||..:.::.:  ..|.|..:.     |.|.|     :.:|.|.:        ..:|..|....|
 Worm    21 HAEMHSAVVTL--ANEIDTNYL-----TSPAK-----IKIVAPLE--------SALIPGGETYQL 65

  Fly   254 KCAATGSPTPTITWRREGGELI----------PLPNGAEAVAYNG---SFLTIAKVNRLNMGAYL 305
            :|....:|..||.| :..|:||          .|.|..:|:...|   |.|||...:..|.|.|.
 Worm    66 RCDIMSTPAATIHW-KFNGKLIQGSNELNVEEKLLNFGKAIVDTGIVASILTIQCPSAENSGTYS 129

  Fly   306 CIASNG--IPPTVS---------------KRVMLIVHFPPMIWIQNQLVGAALTQNI-TLECQSE 352
            |:..||  ...||:               |....||     .|..::.   .:|.|: ||.|::.
 Worm   130 CVGYNGHQTIETVAEVEIEGEASGCRSNHKSAPEIV-----FWTDSRF---EMTGNVATLVCRAN 186

  Fly   353 AYPKSINY-WMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGA 416
               :.::: ||.||.::...::|   |..|...:.::..:::    |.|.|.|:|:|..|:....
 Worm   187 ---QQVDWVWMSNDELVKNNDKF---TVLSNGDLVIKNIVWD----DMGTYTCIARNQFGEARQE 241

  Fly   417 IKLY 420
            ..||
 Worm   242 TFLY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 8/40 (20%)
IG_like 137..230 CDD:214653 8/40 (20%)
IG_like 240..324 CDD:214653 28/113 (25%)
IGc2 247..310 CDD:197706 22/75 (29%)
Ig 327..419 CDD:299845 20/93 (22%)
IG_like 343..420 CDD:214653 18/78 (23%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 29/108 (27%)
Ig 65..144 CDD:143165 25/79 (32%)
IG_like 176..245 CDD:214653 18/78 (23%)
Ig <193..238 CDD:299845 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.