DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Ncam2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:685 Identity:144/685 - (21%)
Similarity:235/685 - (34%) Gaps:171/685 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RRQRRRAAGKLQRKREMPEISSRLIVATATAAVVS-----------IICLSLALPGCAAQESDDE 71
            |.|...|.|:.|....:.||..:|    ....|||           ::|...:.|..|.      
Mouse    92 RCQATDAKGQTQEATVVLEIYQKL----TFREVVSPQEFKQGEDAEVVCRVSSSPAPAV------ 146

  Fly    72 GELHHLDQM------------HHQHQDFIIGESEEHDHIAHHLAEMQNKDELLEDIREDTVVNAI 124
            ..|:|.:::            ::..|...|.:|:|..:......|.:.:.:..:.|   .:||..
Mouse   147 SWLYHNEEVTTIPDNRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDII---VIVNVP 208

  Fly   125 PEKDLPK--FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSI 187
            |...:|:  |     |.|.....|..|.|.........|:|.|         ...:|.:|.:..:
Mouse   209 PAIMMPQKSF-----NATAERGEEMTLTCKASGSPDPTISWFR---------NGKLIEENEKYIL 259

  Fly   188 THAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQ-VGYLDVVVPPDILDYPTSTDMVIREGSNV 251
            ..:...   |.:|::...|.|.|:|:......:.| ..:|.|.|.|.||.....|   ..|..:|
Mouse   260 KGSNTE---LTVRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNET---TSENGHV 318

  Fly   252 TLKCAATGSPTPTITWRR--------EGGELIPLPNG-AEAVAYNG-SFLTIAKVNRLNMGAYLC 306
            ||.|.|.|.|.|.|||:|        ||.:   .|:| .|....:| |.|.|..|...:.|.|.|
Mouse   319 TLVCEAEGEPVPEITWKRAIDGVMFSEGDK---SPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDC 380

  Fly   307 IASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQN-ITLECQSEAYPKSINYWMKNDTIIVP 370
            .|::.|... .:.:.|.:.:.|. ::.||.:..:...| |.:.|...|.|.:..:| :.:.:::|
Mouse   381 EAASRIGGH-QRSMHLDIEYAPK-FVSNQTMYYSWEGNPINISCDVTANPPASIHW-RREKLLLP 442

  Fly   371 GERFVP-ETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLG--------------DTDGAIKLY 420
            .:.... :|...|.|  |.|.|......|||.|.|.|.|.:|              .:...:|:.
Mouse   443 AKNTTHLKTHSVGRK--MILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKII 505

  Fly   421 HIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFNPGNSQQNT-KLQRGKSNS 484
            .:.|||..                :.:||.:.:|...   .:.|..:.......| |:.|    |
Mouse   506 ELSQTTAK----------------ISFNKPESHGGVP---IHHYQVDVKEVASETWKIVR----S 547

  Fly   485 KG-------SDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHG 542
            .|       |...|:....:.|.|.    |.:.....|......:...|:......|.|......
Mouse   548 HGVQTMVVLSSLEPNTTYEIRVAAV----NGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKS 608

  Fly   543 SDHGASYRSDGKSP---HLTNHDAKSLTDD--------------LDRMQDLKGW------ASRLS 584
            .....:.:.||.:|   ::..:.:|...|.              |:.:|...|:      |:||.
Mouse   609 FKISITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLG 673

  Fly   585 PISPI--------------------LGLSMILGVG 599
            ...|.                    |||..|:|:|
Mouse   674 YSEPTVYEFSMPPKPNIIKDTLFNGLGLGAIIGLG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 19/93 (20%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/3 (33%)
Ig 232..324 CDD:472250 33/101 (33%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 22/82 (27%)
Ncam2NP_001106679.1 IgI_1_NCAM-2 21..113 CDD:409452 7/20 (35%)
Ig strand A 21..26 CDD:409452
Ig strand A' 29..33 CDD:409452
Ig strand B 35..45 CDD:409452
Ig strand C 49..55 CDD:409452
Ig strand C' 58..60 CDD:409452
Ig strand D 66..72 CDD:409452
Ig strand E 74..82 CDD:409452
Ig strand F 89..96 CDD:409452 2/3 (67%)
Ig strand G 101..112 CDD:409452 2/10 (20%)
IG_like 122..187 CDD:214653 10/70 (14%)
Ig strand B 132..136 CDD:409353 0/3 (0%)
Ig strand C 145..152 CDD:409353 2/12 (17%)
Ig strand E 169..173 CDD:409353 0/3 (0%)
Ig strand F 183..187 CDD:409353 0/3 (0%)
Ig strand G 191..194 CDD:409353 1/2 (50%)
IgI_1_MuSK 209..298 CDD:409562 21/105 (20%)
Ig strand A 209..212 CDD:409562 1/2 (50%)
Ig strand A' 217..222 CDD:409562 2/9 (22%)
Ig strand B 228..235 CDD:409562 2/6 (33%)
Ig strand C 241..246 CDD:409562 2/4 (50%)
Ig strand C' 248..250 CDD:409562 0/1 (0%)
Ig strand D 257..260 CDD:409562 0/2 (0%)
Ig strand E 264..270 CDD:409562 1/8 (13%)
Ig strand F 277..284 CDD:409562 3/6 (50%)
Ig strand G 290..298 CDD:409562 2/7 (29%)
Ig 300..397 CDD:472250 34/103 (33%)
Ig strand B 318..322 CDD:409353 3/3 (100%)
Ig strand C 331..335 CDD:409353 2/3 (67%)
Ig strand E 363..367 CDD:409353 2/3 (67%)
Ig strand F 377..382 CDD:409353 2/4 (50%)
Ig strand G 390..393 CDD:409353 0/2 (0%)
Ig_3 401..479 CDD:464046 22/81 (27%)
FN3 496..588 CDD:238020 19/118 (16%)
fn3 594..678 CDD:394996 13/83 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.