DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and zig-8

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:209 Identity:51/209 - (24%)
Similarity:80/209 - (38%) Gaps:49/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DELLEDIRED---------TVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWL 164
            :|::..:|::         |:||.:.|                  ..|.|.|.|.....::|||.
 Worm    24 EEVMACLRQERSRVENPSQTIVNVVAE------------------NPAYLHCSVPPDAEHEIAWT 70

  Fly   165 RVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVV 229
            ||....:||..|...|::.|..::......|:|.:|..::.|.|.|:|:||.........||.|:
 Worm    71 RVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVL 135

  Fly   230 VPPDILDYPTSTD------MVIREGSNVTLKCAATGSPTP----TITWRREGGELIPLPNGAEAV 284
            .||  |..|:|..      |....|..|.|.|..|.:...    .:.|.|:|          ..:
 Worm   136 EPP--LPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTRDG----------NTI 188

  Fly   285 AYNGSFLTIAKVNR 298
            .:|.:...|.||.|
 Worm   189 NFNDTEKYILKVKR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 26/92 (28%)
IG_like 137..230 CDD:214653 26/92 (28%)
IG_like 240..324 CDD:214653 15/69 (22%)
IGc2 247..310 CDD:197706 13/56 (23%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
zig-8NP_499714.1 IG_like 55..134 CDD:214653 24/78 (31%)
Ig 55..129 CDD:143165 22/73 (30%)
ig 158..229 CDD:278476 13/55 (24%)
IG_like 158..227 CDD:214653 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.