DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Opcml

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:303 Identity:99/303 - (32%)
Similarity:156/303 - (51%) Gaps:26/303 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI 196
            |.:.:.||||.....|.|:|.:|:..| ::|||  :..|||...|...:.:.|:.|.......:.
  Rat    38 FPKAMDNVTVRQGESATLRCTIDDRVT-RVAWL--NRSTILYAGNDKWSIDPRVIILVNTPTQYS 99

  Fly   197 LRIRDVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATG 259
            :.|::|...|:|.|.|.:.||  |..|:| :|.|.|||.|::  .|:|:.:.|||:|||.|.|.|
  Rat   100 IMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIMN--ISSDITVNEGSSVTLLCLAIG 161

  Fly   260 SPTPTITWR----REGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRV 320
            .|.||:|||    :||          :.......:|.|:.:.|...|.|.|.|.|.:.....::|
  Rat   162 RPEPTVTWRHLSVKEG----------QGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKV 216

  Fly   321 MLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKI 385
            .:.|::||.| .:.:..|.::.|...|.|::.|.|.:...|.|.||.:..|...|  ..|:..:|
  Rat   217 KITVNYPPYI-SKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGV--RIENKGRI 278

  Fly   386 TMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTM 428
            : .||.:.|..:|:|.|.|||.|.||:|:.:|.||.|..::.:
  Rat   279 S-TLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 31/94 (33%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 30/95 (32%)
Ig strand B 251..255 CDD:409275 3/3 (100%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 26/80 (33%)
OpcmlXP_017450901.1 Ig 44..132 CDD:472250 30/91 (33%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 29/82 (35%)
Ig 224..312 CDD:472250 30/91 (33%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/4 (25%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.