DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and ncam2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:650 Identity:123/650 - (18%)
Similarity:202/650 - (31%) Gaps:255/650 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DIREDTVVNAIPEKDLPKFGELLQNVTVPVSR-----EAVLQCVVDNLQTYKIAWLRVDTQTILT 173
            :|.|||          .|| |||||..:.|.:     |.|.:|..           ||:.:..:.
Zfish   153 EITEDT----------EKF-ELLQNNNLQVQKVTKADEGVYRCEA-----------RVEARGEID 195

  Fly   174 IQNHVITKN--------------------------------------HRMSITHAEKRAWILR-- 198
            .:|.::..|                                      ||..:...|...:::|  
Zfish   196 FRNIILVVNVPPVVSVPQQSFNATADYGESVTFTCRAYGSPEPDVTWHRKGVQLQESERYVMRAR 260

  Fly   199 -----IRDVKESDKGWYMCQINTDPMKSQVG------YLDVVVPPDILDYPTSTDMVIREGSNVT 252
                 :|::::.|.|.|.|:.:     ::.|      :|.|.|.|.|......|.:   |||...
Zfish   261 GTTLTVRNIQQDDGGSYTCRAS-----NKAGEVEHELFLKVFVQPHITKLRNVTAV---EGSAAM 317

  Fly   253 LKCAATGSPTPTITWRR--------EGGELIPLPNGAEAV--AYNGSFLTIAKVNRLNMGAYLCI 307
            :.|.|.|.|.|.|:|||        :|.:   .|:|...|  .|..|.|||..|...:.|.:.|.
Zfish   318 ISCKAEGEPLPEISWRRASDGHSFSDGDK---SPDGRVEVRGRYGESMLTIVVVKLSDWGRFDCE 379

  Fly   308 ASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGE 372
            |.:.|... .|.:.|.:.:.|.....:.:..:.....:.:.|...:.|.:...| :.:.:.:|.|
Zfish   380 ALSRIGGH-QKSMFLDIEYAPKFQANHTIFFSWEGNPVNISCDVMSNPPATMLW-RREKLTIPSE 442

  Fly   373 RFVPETFESGYKITMR---------LTIYEVDIQDFGAYRCVAKNSLG--------------DTD 414
                   .:|   .||         |.:..:..:|||.|.|.|:|::|              ...
Zfish   443 -------GAG---NMRVYTAPGRSLLEVTPMSDRDFGRYNCTARNNIGMRFQEFILAQADVPSNP 497

  Fly   415 GAIKLYHIPQTTTMTTMAPTVSINTVPV--VLVKYN--KEQRYGSSQNSNTNPY----NFNPGNS 471
            .:::|..:.|.....|.....|...||:  .||||.  ..|.:...::..|...    |..|..:
Zfish   498 YSVRLSSVAQRVATVTFTKPDSHGGVPISHYLVKYKDISSQDWKDVKSLGTQTIVLLTNLEPNTT 562

  Fly   472 QQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSS---------SSSSSASSRGRD 527
            .:                       |.|.|.:.....:..|:.|         |..|....||  
Zfish   563 YE-----------------------VRVSAVNGKGQGEFSHTESFQTLPIREPSPPSVQGQRG-- 602

  Fly   528 HHQQQHHQQQQQNHGSDHGASYR------SDGKSPHLTNHDAKSLTDDLDRMQDLKGWASRLSP- 585
                             .|.:||      .||..| :..:..|..||..::      |.::|.| 
Zfish   603 -----------------VGKAYRLGLVKQDDGGMP-ILEYIVKYKTDKEEQ------WMTKLVPG 643

  Fly   586 ------ISPI------------------------------------------LGLSMILGVGYLG 602
                  :.|:                                          |||..::|:|..|
Zfish   644 VNDFVLLQPLQWNTQYEVEITARNVKGLSEPTVVKFSMPQKPDITADSLFSGLGLGAVVGLGLAG 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 22/148 (15%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 1/10 (10%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 31/101 (31%)
Ig strand B 251..255 CDD:409275 0/3 (0%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 2/3 (67%)
Ig strand F 303..308 CDD:409275 1/4 (25%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 16/89 (18%)
ncam2NP_571905.1 IgI_1_NCAM-2 20..112 CDD:409452
Ig strand A 20..25 CDD:409452
Ig strand A' 28..32 CDD:409452
Ig strand B 34..44 CDD:409452
Ig strand C 48..54 CDD:409452
Ig strand C' 57..59 CDD:409452
Ig strand D 65..71 CDD:409452
Ig strand E 73..81 CDD:409452
Ig strand F 88..95 CDD:409452
Ig strand G 100..111 CDD:409452
Ig 131..194 CDD:409353 17/62 (27%)
Ig strand B 131..135 CDD:409353
Ig strand C 144..148 CDD:409353
Ig strand F 181..186 CDD:409353 2/4 (50%)
IgI_1_MuSK 213..296 CDD:409562 11/87 (13%)
Ig strand A' 215..220 CDD:409562 0/4 (0%)
Ig strand B 226..233 CDD:409562 0/6 (0%)
Ig strand C 239..244 CDD:409562 0/4 (0%)
Ig strand C' 246..248 CDD:409562 0/1 (0%)
Ig strand D 255..258 CDD:409562 0/2 (0%)
Ig strand E 262..268 CDD:409562 0/5 (0%)
Ig strand F 275..282 CDD:409562 3/6 (50%)
Ig strand G 288..296 CDD:409562 1/7 (14%)
Ig 298..395 CDD:472250 32/103 (31%)
Ig strand B 316..320 CDD:409353 0/3 (0%)
Ig strand C 329..333 CDD:409353 1/3 (33%)
Ig strand E 361..365 CDD:409353 2/3 (67%)
Ig strand F 375..380 CDD:409353 1/4 (25%)
Ig strand G 388..391 CDD:409353 1/2 (50%)
IG_like 411..488 CDD:214653 17/87 (20%)
Ig strand B 416..420 CDD:409353 0/3 (0%)
Ig strand C 429..433 CDD:409353 1/4 (25%)
Ig strand E 456..460 CDD:409353 1/3 (33%)
Ig strand F 470..475 CDD:409353 2/4 (50%)
FN3 <487..>675 CDD:442628 36/236 (15%)
FN3 494..586 CDD:238020 19/114 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.