DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-theta and pigrl4.2

DIOPT Version :9

Sequence 1:	NP_723103.1	Gene:	DIP-theta / 33795	FlyBaseID:	FBgn0051646	Length:	606	Species:	Drosophila melanogaster
Sequence 2:	NP_001293038.1	Gene:	pigrl4.2 / 105665605	ZFINID:	ZDB-GENE-150409-10	Length:	240	Species:	Danio rerio

Alignment Length:	131	Identity:	29/131 - (22%)
Similarity:	55/131 - (41%)	Gaps:	31/131 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   137 QNVTVPVSREAVLQCVVDNLQTYKI---------AWLRVDTQTILTIQNHVITKNHRMSIT-HAE 191
            :.:|:|        |:.||  .||:         .||..   :::...||    ..:.:|| :.:
Zfish    32 ETITIP--------CLYDN--KYKLNKKYWCNGNTWLGC---SVVAYANH----TGKWTITDYPD 79

  Fly   192 KRAWILRIRDVKESDKGWYMCQINTDPM--KSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLK 254
            ...:.:.:.:...||.|.|.|.:..|..  .|:..||.|...||:  ...|:.:...:|.:|:::
Zfish    80 HNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSKYLYLTVQKAPDV--SVLSSSVSGHKGDDVSVR 142

  Fly   255 C 255
            |
Zfish   143 C 143

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-theta	NP_723103.1	Ig	137..230	CDD:299845	23/104 (22%)
		IG_like	137..230	CDD:214653	23/104 (22%)
		IG_like	240..324	CDD:214653	4/16 (25%)
		IGc2	247..310	CDD:197706	3/9 (33%)
		Ig	327..419	CDD:299845
		IG_like	343..420	CDD:214653
pigrl4.2	NP_001293038.1	IG_like	26..118	CDD:214653	22/102 (22%)
		Ig_pIgR	30..117	CDD:143193	21/101 (21%)
		Ig	133..217	CDD:299845	3/11 (27%)
		IG_like	136..218	CDD:214653	3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	40	1.000	Domainoid score	I12510
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.000