DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and pigrl3.9

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_073787198.1 Gene:pigrl3.9 / 103910135 ZFINID:ZDB-GENE-150409-8 Length:396 Species:Danio rerio


Alignment Length:140 Identity:32/140 - (22%)
Similarity:64/140 - (45%) Gaps:11/140 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NVTVPVSREAVLQCVV-DNLQTYKIAWLR---VDTQTILTIQNHVITKNHRMSIT-HAEKRAWIL 197
            |:.|......::.|:. :..:.::..|.|   ..:.:|||..|.  |:| :.||| :..:..:.:
Zfish    44 NIGVKSGSPGIIPCLYEEQYKEHQKYWCRGYIWSSCSILTFVNE--TRN-KFSITDYPAQSIFTV 105

  Fly   198 RIRDVKESDKGWYMCQINT-DPMKSQVG-YLDVVVPPDILDYPTSTDMVIREGSNVTLKC-AATG 259
            ...:::||:..:|.|.:.. .|.....| |:.:.|..|......|:.:...||.:|:::| .::|
Zfish   106 EWENLQESNSSYYWCAVEIGGPGTLDAGYYVYLTVQSDPAVSVMSSSVSGHEGDDVSVQCFYSSG 170

  Fly   260 SPTPTITWRR 269
            ....|..|.|
Zfish   171 YKAKTKQWCR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 21/98 (21%)
Ig strand B 147..151 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 10/39 (26%)
Ig strand B 251..255 CDD:409275 1/3 (33%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275
Ig strand F 303..308 CDD:409275
Ig strand G 317..320 CDD:409275
Ig_3 327..408 CDD:464046
pigrl3.9XP_073787198.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.