DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and iglon5

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:286 Identity:86/286 - (30%)
Similarity:143/286 - (50%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIRDV 202
            |.||.....|.|.|::|:..| ::|||  :...||.......:.:.|:.:....|..:.:.|..|
 Frog    35 NYTVSQGDNATLSCLIDDKVT-RVAWL--NRSNILYAGKDKWSIDSRVQLLTNTKSEYSIVITHV 96

  Fly   203 KESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTI 265
            ..:|:|.|.|...|:  |..||| ||.|.||..|::  .|:.:.:.|||||.|:|.|.|.|.|||
 Frog    97 DVADEGLYTCSFQTEDKPHTSQV-YLIVQVPAKIVN--ISSSVTVNEGSNVNLQCLAVGKPEPTI 158

  Fly   266 TWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMI 330
            ||::.          :|..:..|..|.|.::||...|.|.|:.|||:....:|:|.:.|::||.|
 Frog   159 TWQQL----------SEGFSSEGELLEITEINRQQAGDYECVTSNGVSVPDTKKVQITV
NYPPYI 213

  Fly   331 W-IQNQLVGAALTQNITLECQSEAYPKSINYWMKND-TIIVPGERFVPETFESGYKITMRLTIYE 393
            . ::|  ..:.:.:..||.|::.|.|.:...|.|:: ..::.|...:....||.:.:   :....
 Frog   214 TDVKN--AQSPVGRPATLRCKAMAVPPAEFEWYKDEKRRLISGTEGLSIKTESSWSV---IVFSN 273

  Fly   394 VDIQDFGAYRCVAKNSLGDTDGAIKL 419
            |..:.:|.|.|:|.|.||..:.:::|
 Frog   274 VTSRHYGNYTCLASNKLGSFNSSLRL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/93 (31%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 2/2 (100%)
Ig 232..324 CDD:472250 31/91 (34%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 3/3 (100%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 19/82 (23%)
iglon5XP_002938252.1 Ig 31..123 CDD:472250 28/91 (31%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 1/3 (33%)
Ig strand E 89..93 CDD:409353 0/3 (0%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 34/96 (35%)
Ig strand B 144..148 CDD:409353 2/3 (67%)
Ig strand C 157..160 CDD:409353 2/2 (100%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353 1/2 (50%)
Ig_3 210..288 CDD:464046 19/82 (23%)

Return to query results.
Submit another query.