DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and igsf9b

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_031761656.1 Gene:igsf9b / 100379858 XenbaseID:XB-GENE-5887265 Length:1392 Species:Xenopus tropicalis


Alignment Length:378 Identity:99/378 - (26%)
Similarity:160/378 - (42%) Gaps:76/378 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TVVNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQT-----YKIAWLRVDTQTILTIQ--- 175
            :|..|...::.|:|      ||.......:|.|.|.:..|     |.:.|.:......:.|:   
 Frog    19 SVQGAGGSREEPQF------VTARAGESVILGCDVVHPLTVQPPPYVVEWFKFGVPIPIFIKFGF 77

  Fly   176 --NHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYMC-------QINTDPMKSQVGYLDVVVP 231
              .||..:....:..: :|.:  |||..|:..|:|||.|       |.:|....|.| :|.|..|
 Frog    78 YPPHVDPEYVGRAALY-DKAS--LRIEQVRSQDQGWYECKVLMLEHQYDTFHNGSWV-HLTVNAP 138

  Fly   232 PDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGEL-----IPLPNGAEAVAYNGSFL 291
            |...:.|... :.::|||::||.|.|.|:|.||::|.|||..|     ..|.:|:         |
 Frog   139 PTFTETPPQY-LEVKEGSSITLTCTAFGNPKPTVSWLREGEFLGRTSKYQLSDGS---------L 193

  Fly   292 TIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPK 356
            ||:.:.|.:.|:|:|.|:: |.........|:|...|.|....:.:...::|:....||:||||.
 Frog   194 TISSIGREDRGSYMCRATS-IQGEAVHSTRLLVQGSPFIVSPPENITVNISQDALFTCQAEAYPG 257

  Fly   357 SIN---YWMKNDTIIVPGERFVPETFESGYKITMR------LTIYEVDIQDFGAYRCVAKNSLGD 412
            ::.   ||.:.:..           |::..|:.:|      |.|:.|..:|.|.|.||..||||.
 Frog   258 NLTYTWYWQEENVF-----------FKNDLKLRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGR 311

  Fly   413 TDGAIKLYHIPQTTTMTTMAPTVSI-------------NTVPVVLVKYNKEQR 452
            :..|.....:.....:..|.|.:.:             ...||..||:||:.|
 Frog   312 SPSASAYLTVQYPARVVNMPPVIYVPVGIHGHIRCPVEAVPPVTFVKWNKDGR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 27/109 (25%)
IG_like 137..230 CDD:214653 27/109 (25%)
IG_like 240..324 CDD:214653 28/88 (32%)
IGc2 247..310 CDD:197706 26/67 (39%)
Ig 327..419 CDD:299845 27/100 (27%)
IG_like 343..420 CDD:214653 25/85 (29%)
igsf9bXP_031761656.1 IG 30..115 CDD:214652 23/93 (25%)
I-set 139..225 CDD:400151 30/96 (31%)
Ig strand A 139..142 CDD:409353 1/2 (50%)
Ig strand A' 148..151 CDD:409353 0/3 (0%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand D 185..189 CDD:409353 0/3 (0%)
Ig strand E 191..195 CDD:409353 2/12 (17%)
Ig strand F 204..212 CDD:409353 4/7 (57%)
Ig strand G 215..225 CDD:409353 1/9 (11%)
I-set 229..321 CDD:400151 27/102 (26%)
Ig strand B 246..250 CDD:409353 0/3 (0%)
Ig strand C 260..264 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 1/3 (33%)
Ig strand F 300..305 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 1/2 (50%)
Ig 344..405 CDD:409353 7/21 (33%)
Ig strand C 355..360 CDD:409353 2/4 (50%)
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig 429..505 CDD:416386
Ig strand A' 429..432 CDD:409353
Ig strand B 438..445 CDD:409353
Ig strand C 451..456 CDD:409353
Ig strand C' 458..460 CDD:409353
Ig strand E 471..476 CDD:409353
Ig strand F 484..492 CDD:409353
Ig strand G 495..505 CDD:409353
FN3 510..605 CDD:238020
FN3 622..703 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.