DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and Kirrel2

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:636 Identity:121/636 - (19%)
Similarity:208/636 - (32%) Gaps:196/636 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PKFGELLQNVTVPVSREAVLQCVVDNLQTYK--IAWLRVDTQTILTIQNHVITKNHRMSITHAEK 192
            |.|.:..:::.|.:.:||.|.|.   |..|:  :.|    |:..|.:              ..|:
  Rat    32 PHFLQQPEDMVVLLGQEARLPCA---LGAYRGLVQW----TKDGLAL--------------GGER 75

  Fly   193 ------RAWI----------LRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPD---ILDYP 238
                  |.||          |.|:.|:..|:..|.||.:...::|:...|.|:|||:   :|..|
  Rat    76 DLPGWSRYWISGNSASGQHDLHIKPVELEDEASYECQASQAGLRSRPAQLHVMVPPEAPQVLGGP 140

  Fly   239 TSTDMVIREGSNVTLKCAATGSPTPTITWRREGGEL-------IPLPNGAEAVAYNGSFLTIAKV 296
             |..:|.....|:|.:......|.|.:.|.|:|..|       |.|.:.|.....|..|||.:..
  Rat   141 -SVSLVAGVPGNLTCRSRGDARPAPELLWFRDGIRLDGTSFHQITLRDKATGTVENTLFLTPSSQ 204

  Fly   297 NRLNMGAYL-CIA-SNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSIN 359
            :.   ||.| |.| |..:|......|.|.:.:|||:.:..:...|...:.:|..||:.|.|....
  Rat   205 DD---GATLICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQTAQEGEKVTFLCQATAQPPVTG 266

  Fly   360 Y-WMKNDTIIVPGER-----------FVPETFE--------SGYKITMRLTIY-----------E 393
            | |.|..:.:: |.|           |:.|...        |..:.|....:|           .
  Rat   267 YRWAKGGSPVL-GARGPRLEVVADATFLTEPVSCEVSNAVGSANRSTALEVLYGPILQAKPKPVS 330

  Fly   394 VDIQDFGAYRCVAKNS---------LG-----DTDGAIKLYHI-------------PQTT----- 426
            ||:....::.||.:.:         ||     .:...::|..:             |:.|     
  Rat   331 VDVGKDASFSCVWRGNPLPRISWTRLGGSQVLSSGPTLRLPSVALEDAGDYVCRAEPRRTGVGGG 395

  Fly   427 ----TMTTMAPTV--SINTVPVVL------------------VKYNKEQRY-------------- 453
                .:|..||.|  :::..|..|                  |.::.::.:              
  Rat   396 TAQARLTVNAPPVVTALHPAPAFLRGPARLQCVVFASPAPDSVVWSWDEGFLEAGSLGRFLVEAF 460

  Fly   454 --------------------GSSQNSNTNPYNFNPGN--SQQNTKLQRGKSN-------SKGSDQ 489
                                |:.::..|..:|.:..|  .:...::..|:.:       ..|:..
  Rat   461 PAPEVEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTVRLVAGAAS 525

  Fly   490 SPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQQNHGSDHGASYRSDGK 554
            :.:.|..|..|.....|.   |.|.|...:.....|.......|..:::.....|.|....:|..
  Rat   526 AATSLFMVITGVVLCCWR---HGSLSKQKNLVRIPGSSEGSSAHGPEEETGSSEDRGPIVHTDHN 587

  Fly   555 SPHLTNHDAKSLTDDLDRMQDLKGWASRLSPISPILGLSMILGVGYLGPWP 605
            ...|..::|....|..:....::|       :|..|.|....|.|...|.|
  Rat   588 DLVLEENEALETKDPTNGYYKVRG-------VSVSLSLGEAPGGGLFLPPP 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 24/110 (22%)
IG_like 137..230 CDD:214653 24/110 (22%)
IG_like 240..324 CDD:214653 26/92 (28%)
IGc2 247..310 CDD:197706 20/71 (28%)
Ig 327..419 CDD:299845 25/136 (18%)
IG_like 343..420 CDD:214653 21/121 (17%)
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653 23/109 (21%)
Ig strand A' 40..44 CDD:409353 0/3 (0%)
Ig strand B 48..57 CDD:409353 5/11 (45%)
Ig strand C 62..66 CDD:409353 1/7 (14%)
Ig strand D 75..85 CDD:409353 1/9 (11%)
Ig strand E 88..100 CDD:409353 2/11 (18%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
Ig strand G 117..127 CDD:409353 2/9 (22%)
Ig 133..231 CDD:416386 28/101 (28%)
Ig strand A 134..137 CDD:409353 0/2 (0%)
Ig strand A' 140..144 CDD:409353 2/4 (50%)
Ig strand B 151..158 CDD:409353 2/6 (33%)
Ig strand C 164..169 CDD:409353 1/4 (25%)
Ig strand C' 172..174 CDD:409353 1/1 (100%)
Ig strand D 177..184 CDD:409353 0/6 (0%)
Ig strand E 191..199 CDD:409353 1/7 (14%)
Ig strand F 208..216 CDD:409353 4/7 (57%)
Ig strand G 222..228 CDD:409353 0/5 (0%)
Ig_3 234..303 CDD:404760 16/69 (23%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand E 283..286 CDD:409353 0/2 (0%)
Ig strand F 292..301 CDD:409353 2/8 (25%)
Ig strand G 309..312 CDD:409353 0/2 (0%)
Ig 326..403 CDD:416386 9/76 (12%)
Ig strand A' 327..332 CDD:409353 0/4 (0%)
Ig strand B 335..344 CDD:409353 2/8 (25%)
Ig strand C 350..354 CDD:409353 0/3 (0%)
Ig strand C' 357..359 CDD:409353 1/1 (100%)
Ig strand D 362..365 CDD:409353 0/2 (0%)
Ig strand E 366..371 CDD:409353 0/4 (0%)
Ig strand F 379..387 CDD:409353 0/7 (0%)
Ig strand G 393..403 CDD:409353 0/9 (0%)
Ig 405..509 CDD:416386 10/103 (10%)
Ig strand A 406..410 CDD:409353 2/3 (67%)
Ig strand A' 412..415 CDD:409353 0/2 (0%)
Ig strand B 423..430 CDD:409353 0/6 (0%)
Ig strand C 437..442 CDD:409353 1/4 (25%)
Ig strand C' 444..447 CDD:409353 0/2 (0%)
Ig strand D 455..462 CDD:409353 0/6 (0%)
Ig strand E 472..479 CDD:409353 0/6 (0%)
Ig strand F 490..497 CDD:409353 1/6 (17%)
Ig strand G 500..507 CDD:409353 0/6 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.