DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and adgrl1.1

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:261 Identity:47/261 - (18%)
Similarity:82/261 - (31%) Gaps:84/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQL 336
            ||.:...:...:.|..| .|...|:|...:|.::|      |.|:.:                  
Zfish    37 GETVSFQHRVTSRAQPG-MLESGKMNNQTLGVFVC------PGTLVR------------------ 76

  Fly   337 VGAALTQNITLECQS--EAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVD-IQD 398
                     .||..|  ||...| ..|.|:.  :..|:|.          ..|..|.|..| :.:
Zfish    77 ---------VLEPSSVREAEDHS-GAWCKDP--LQAGDRL----------YVMPWTPYRTDMLYE 119

  Fly   399 FGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNP 463
            :.::....:|.:..|      |.:|.....|.             .|.|:....|...:..|...
Zfish   120 YASWDDYIQNRVTTT------YKLPSRVDGTG-------------FVVYDGAVFYNKERTRNIVK 165

  Fly   464 YNFNPGNSQQNTKLQRGKS---NSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRG 525
            |:.       .|:::.|::   |:...|.||     ...|..|.:..:.|.|......::.::.|
Zfish   166 YDL-------RTRIKSGEAVIVNANYHDASP-----YHRGGKSDIDLAVDEHGLWVIYTTEANNG 218

  Fly   526 R 526
            |
Zfish   219 R 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845
IG_like 137..230 CDD:214653
IG_like 240..324 CDD:214653 11/51 (22%)
IGc2 247..310 CDD:197706 9/37 (24%)
Ig 327..419 CDD:299845 16/94 (17%)
IG_like 343..420 CDD:214653 16/79 (20%)
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 37/219 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.