DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and si:ch211-215e19.3

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_002660995.5 Gene:si:ch211-215e19.3 / 100332384 ZFINID:ZDB-GENE-060503-685 Length:280 Species:Danio rerio


Alignment Length:206 Identity:50/206 - (24%)
Similarity:83/206 - (40%) Gaps:32/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 NVTVPVSREAVLQCVVDNLQTYK-----IAW-LRVDTQTILTIQNHVITKNHRMSIT-HAEKRAW 195
            |:.|......::.|:.|  :.||     ..| ....|.:||...|.  |:| :.||| :..:..:
Zfish    40 NIGVKSGSPGIIPCLYD--EQYKEHQKFWCWGTFFSTCSILAYVNE--TRN-KFSITDYPAQSIF 99

  Fly   196 ILRIRDVKESDKGWYMCQINT-DPMKSQVG---YLDVVVPPDILDYPTSTDMVIREGSNVTLKC- 255
            .:..::::.||..:|.|.:.. .|.....|   ||.|...||:....:|...  .||.||:::| 
Zfish   100 TVEWQNLQLSDSSYYWCVVEIGGPGTLDAGYYLYLTVQSAPDLSVMNSSVSG--HEGGNVSVQCF 162

  Fly   256 AATGSPTPTITW-RREGGELIP------LPNGAEAVAYNGSFLTIAKVNRLNM---GAYLCIASN 310
            .::|....|..| |.:.....|      ..|.:..::.:|.......:..|.:   |.|.|.|.|
Zfish   163 YSSGYKNKTKQWCRVKDKSCFPENKTDTFQNSSVQISDDGESCFTVLMTGLTLSDSGWYFCSAGN 227

  Fly   311 GIPP---TVSK 318
            ...|   ||:|
Zfish   228 LQVPVQLTVTK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 25/102 (25%)
IG_like 137..230 CDD:214653 25/102 (25%)
IG_like 240..324 CDD:214653 23/93 (25%)
IGc2 247..310 CDD:197706 17/73 (23%)
Ig 327..419 CDD:299845
IG_like 343..420 CDD:214653
si:ch211-215e19.3XP_002660995.5 Ig 51..122 CDD:325142 18/75 (24%)
Ig 149..235 CDD:325142 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.