DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and LOC100332092

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_073787192.1 Gene:LOC100332092 / 100332092 -ID:- Length:374 Species:Danio rerio


Alignment Length:389 Identity:72/389 - (18%)
Similarity:120/389 - (30%) Gaps:144/389 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 ITHAEKRAWILRIR-------------DVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYP 238
            :.|....|||:|::             ..||..|.|  ||          ||.            
Zfish    11 LLHIGDGAWIIRVKSGSPGNIPCLYEEQYKEHQKFW--CQ----------GYF------------ 51

  Fly   239 TSTDMVIREGSNVTLKCAATGSPTP---TITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLN 300
            .||..::...:....|.:.|..|..   |:.|:    .|.|..:|     |....:.|.....|:
Zfish    52 WSTCAILTFVNETRNKFSITDYPAQSIFTVEWQ----NLQPSDSG-----YYWCAVEIGGAETLD 107

  Fly   301 MGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLEC-QSEAYPKSINYWMKN 364
            .|.|               |.|.|...|.:.:.|..|......|::::| .|..|......|.: 
Zfish   108 AGYY---------------VHLTVRSAPDVSVMNSSVSGHEGGNVSVQCFYSSGYKAYNKQWCR- 156

  Fly   365 DTIIVPGERFVPETFESGYKITMRLT----------IYEVDIQDFGAYRCVAKN-----SLGDTD 414
               :.....|..|..::...::::::          :..:::.|.|.|.|...|     .|..|.
Zfish   157 ---VKDKSCFTEEKMDTSQNLSVQISDDGKSFFTVLMTGLNLSDSGWYFCSVGNLKVPVQLTVTK 218

  Fly   415 GAIKLYHIPQTTTMTTMAPT------------VSINTVP-----------VVLV----------- 445
            ...|:...|:.|:.|.|:.|            .:|||:.           |:|:           
Zfish   219 PEPKVLTTPKYTSETEMSTTQLSTNTTSTIMHSTINTLKTSKPMGAYMDNVILIMCLATTLMLLL 283

  Fly   446 -------------------KYNKEQRYGSSQNSNTNPYNFNPGNSQQNTKLQRGKSNSKGSDQS 490
                               :..||:|..|| ..||.|      :..|.|.:...:::|...|.|
Zfish   284 LVALFAIVICRMRKNQEGEQIKKEERVDSS-TMNTMP------SENQMTSISPAEADSSADDPS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 13/55 (24%)
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 17/94 (18%)
Ig strand B 251..255 CDD:409275 0/3 (0%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 0/3 (0%)
Ig strand F 303..308 CDD:409275 1/4 (25%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 14/91 (15%)
LOC100332092XP_073787192.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.