DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and ncam2

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_012811963.1 Gene:ncam2 / 100151722 XenbaseID:XB-GENE-1217730 Length:865 Species:Xenopus tropicalis


Alignment Length:517 Identity:116/517 - (22%)
Similarity:189/517 - (36%) Gaps:158/517 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 REDTVVNAIPEK----DLP-----KFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTI 171
            :|.|||..|.:|    |:|     |.||           .|.:.|:|.:.....:.||       
 Frog   132 QEATVVLEIYQKLTFEDVPSPQEFKRGE-----------NAEVLCLVSSSPAPMVRWL------- 178

  Fly   172 LTIQNHVITKNHRMSITHAEKRAWI------LRIRDVKESDKGWYMCQINTDPMKSQVGYLD--- 227
                      |:|..:|..:.|.:.      |:|:::.:.|:|.|.|:...: ::.::.:.|   
 Frog   179 ----------NNREDVTDIDDRRFAMLPNNNLQIKNISKRDEGIYRCEGRVE-VRGEIDFRDISV 232

  Fly   228 -VVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFL 291
             |.|||:||....|.:.......::||.|.|||||.|.|||.| .|:|:. .|....:..:.:.|
 Frog   233 IVNVPPEILAQQRSFNATADRLEDITLFCRATGSPKPYITWHR-NGKLVE-ENEKYDLREDNTEL 295

  Fly   292 TIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLV---GAALTQNITLECQSEA 353
            |:..:...:.|.|:|.|:|....|..:..:.:...|.::.:||:..   |     ::||.|::|.
 Frog   296 TVKNIISTDSGLYVCRATNKAGFTEKQSFLQVFVQPHIVQLQNETTIEHG-----HVTLTCEAEG 355

  Fly   354 YPKSINYWMKND--TIIVPGERFVPETFES-GYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDG 415
            .|.....|.::.  .|...|::......|| |:.....|.|..|.:.|.|.|.|.|.:.:|....
 Frog   356 EPIPEITWKRSSDGMIFYDGDKSQDGRIESTGHHGKSSLHIKSVMLSDAGRYDCEAASRIGGHQK 420

  Fly   416 AIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQR-YGSSQNSNTNPYNFN------------ 467
            ::.|                :|...|    |:...|. |.|.:|   ||.|.:            
 Frog   421 SMYL----------------NIEYAP----KFISNQTIYYSWEN---NPINISCDVTSNPPSSIY 462

  Fly   468 --------PGNSQQNTKLQR-GKS---------------------NSKGS------------DQS 490
                    |..:..|.|..| ||.                     ||.||            ..|
 Frog   463 WSRDKLLLPARNITNIKTYRDGKRILLEITPLSDNDFGRYNCTAINSIGSRIQEYILTLADVPSS 527

  Fly   491 PSGLNNVFVGATSS--LWNSQDHHSSSSSSSSASSRGRDHHQQQHHQQQQ-------QNHGS 543
            |.||..:.:..|.:  .:|..|.|.....          ||.|...::..       ::||:
 Frog   528 PYGLRVIELSQTYAKVFFNKPDSHGGVPI----------HHYQMDFKEVSSEIWKVVRSHGT 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 17/102 (17%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 1/9 (11%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 28/91 (31%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 2/3 (67%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 23/86 (27%)
ncam2XP_012811963.1 Ig 50..142 CDD:472250 5/9 (56%)
Ig strand B 67..71 CDD:409452
Ig strand C 79..83 CDD:409452
Ig strand E 105..109 CDD:409452
Ig strand F 119..124 CDD:409452
Ig strand G 133..136 CDD:409452 1/2 (50%)
IG_like 150..234 CDD:214653 20/112 (18%)
Ig strand B 161..165 CDD:409353 1/3 (33%)
Ig strand C 174..178 CDD:409353 0/3 (0%)
Ig strand E 198..202 CDD:409353 1/3 (33%)
Ig strand F 212..217 CDD:409353 2/4 (50%)
Ig 238..327 CDD:472250 28/90 (31%)
Ig strand B 257..261 CDD:409301 2/3 (67%)
Ig strand C 270..274 CDD:409301 2/3 (67%)
Ig strand E 293..297 CDD:409301 1/3 (33%)
Ig strand F 307..312 CDD:409301 2/4 (50%)
Ig strand G 320..323 CDD:409301 0/2 (0%)
Ig 329..426 CDD:472250 25/117 (21%)
Ig strand B 347..351 CDD:143278 2/3 (67%)
Ig strand C 360..364 CDD:143278 0/3 (0%)
Ig strand E 392..396 CDD:143278 1/3 (33%)
Ig strand F 406..411 CDD:143278 2/4 (50%)
Ig strand G 419..422 CDD:143278 0/2 (0%)
Ig_3 430..508 CDD:464046 15/84 (18%)
FN3 525..617 CDD:238020 13/65 (20%)
fn3 623..707 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.