DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and si:ch211-9d9.7

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_073787427.1 Gene:si:ch211-9d9.7 / 100150985 ZFINID:ZDB-GENE-060503-422 Length:232 Species:Danio rerio


Alignment Length:212 Identity:44/212 - (20%)
Similarity:77/212 - (36%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 DYPTSTDMVIREGSNVTLKC--------------AATGSPTPTITWRREGGELIPLPNGAEAVAY 286
            |:.||| :.::.|.:||:.|              :.|..|........|...:|..|        
Zfish    19 DWLTST-ITVQPGGSVTIPCYYDEKYTPQKKYWNSGTDKPNKYTNTTEENLSVIDHP-------- 74

  Fly   287 NGSFLTIAKVNRLN--MGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLEC 349
            :.|..|:...|..:  .|.|.|:...|....|:..:.|:||..|.:.:.:..|......::.::|
Zfish    75 DQSLFTVTMRNLQDNQAGDYYCVVETGGKLNVTYELFLLVHSAPAMSVMSSSVSGHEGDDVRVQC 139

  Fly   350 -QSEAYPKSINYW-----------MKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAY 402
             .|.||...:..|           .|.||......: :.:..||.:.:.|.    .:.:.|.|.|
Zfish   140 FYSSAYKYQLKRWCRYKDQKCFSEKKTDTSQSSSVQ-ISDDGESSFTVLMT----GLRLSDSGWY 199

  Fly   403 RCVAKNSLGDTDGAIKL 419
            .|    |:|.....::|
Zfish   200 FC----SVGHLQAPVQL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353
Ig strand F 209..214 CDD:409353
Ig strand G 221..224 CDD:409353
Ig 232..324 CDD:472250 22/103 (21%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 17/92 (18%)
si:ch211-9d9.7XP_073787427.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.