DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and lrit3b

DIOPT Version :9

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:464 Identity:85/464 - (18%)
Similarity:152/464 - (32%) Gaps:170/464 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LEDIRED-TVVNAIP---EKDLPKFGEL-LQN---VTVPVSREAVLQCVVDNLQTYKIAWLRVDT 168
            |.::|.| .:::..|   .:|:|:...| |.|   ..:|:.....|:         .:.:|.:.:
Zfish   138 LHELRLDGNLLSTFPWEGLRDMPRLRTLGLHNNRLARIPLLAVRYLR---------NVTYLDLSS 193

  Fly   169 QTILTIQNHVITKNHRMSITHAEKRAWILRIRDVKESDKGWYM-CQINT------DPMKSQV--- 223
            ..:.|:.|. :|.....|.::..:|:::|.::     |..|.. |:::|      .|..|.|   
Zfish   194 NRLSTLAND-LTALWLFSDSNQTQRSFVLGLQ-----DNPWVCDCRLSTLLDISRGPESSLVLLD 252

  Fly   224 GYLDVVVPPDILDYP----------------TSTDMVIREGSNVTLKCAATGSPTPTITWRREGG 272
            .:|....|.|:...|                ::|.:....||.|.|:|.|||.|||.:.|     
Zfish   253 RFLTCSEPLDLAGVPFQSVELSRCRRPYVVTSATKITALLGSTVLLRCEATGHPTPALMW----- 312

  Fly   273 ELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLV 337
                              :..||.|..|.|   |...                            
Zfish   313 ------------------IKSAKRNLYNQG---CCKQ---------------------------- 328

  Fly   338 GAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYEVDIQDFGAY 402
                ||:   ...:|.:||.:             ..:|.|:...|.:.:: :::..:...|.|.|
Zfish   329 ----TQS---SLDTERFPKKL-------------FGYVQESPRVGVRWSV-VSLNGISYSDAGEY 372

  Fly   403 RCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFN 467
            ||.|:|..|.::.                  .||:|.|.|:       ..|...:||:       
Zfish   373 RCRAQNMAGISEA------------------VVSLNVVGVM-------AEYTDFKNSD------- 405

  Fly   468 PGNSQQNTKLQRGKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRDHHQQQ 532
                ||.|..:.....:|...:|.:.:.....|:.|.|          .........|||..::.
Zfish   406 ----QQQTTTKSDSKRTKPKQKSKAMMPRNMTGSLSPL----------KRVLKTPKAGRDKMKRD 456

  Fly   533 HHQQQQQNH 541
            ....|:.:|
Zfish   457 RTAVQKLSH 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 18/105 (17%)
IG_like 137..230 CDD:214653 18/105 (17%)
IG_like 240..324 CDD:214653 19/83 (23%)
IGc2 247..310 CDD:197706 18/62 (29%)
Ig 327..419 CDD:299845 16/91 (18%)
IG_like 343..420 CDD:214653 15/76 (20%)
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566 9/33 (27%)
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378 5/22 (23%)
LRR_8 160..214 CDD:290566 11/63 (17%)
LRR_4 160..201 CDD:289563 8/49 (16%)
leucine-rich repeat 162..185 CDD:275378 5/31 (16%)
leucine-rich repeat 186..199 CDD:275378 1/12 (8%)
leucine-rich repeat 215..230 CDD:275378 4/19 (21%)
Ig 278..391 CDD:299845 37/205 (18%)
I-set 279..391 CDD:254352 37/204 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.