DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and negr1

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:341 Identity:100/341 - (29%)
Similarity:162/341 - (47%) Gaps:37/341 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWILRIR 200
            :.|:.|.....|:|:|.::. ...|.|||  :..:|:.......:.:.|:||..:.|:.:.|||:
 Frog    46 VDNLVVRQGETAMLRCFLEE-GASKGAWL--NRSSIIFAGGDKWSVDPRVSIATSSKQEYSLRIQ 107

  Fly   201 DVKESDKGWYMCQINTD--PMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTP 263
            .|..||.|.|.|.:.|:  |...|| :|.|.|.|.|  |..|:||.:.||:||:|.|.|||.|.|
 Frog   108 KVDVSDDGPYTCSVQTEHSPRTLQV-HLTVHVSPKI--YDISSDMTVNEGTNVSLICLATGKPEP 169

  Fly   264 TITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPP 328
            :|:||.       :...|:... :|.:|.|..:.|...|.|.|.|.|.:.....|:|.:.|:|.|
 Frog   170 SISWRH-------ISPSAKQFG-SGQYLDIYGITRDQAGDYECSAENDVSFPDVKKVKVTVNFAP 226

  Fly   329 MIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTIIVPGERFVPETFESGYKITMRLTIYE 393
            .| ::....|.:|.:...:.|::.|.|..:..|.|.:..:..|:|.:.   ...|.....||:..
 Frog   227 TI-LEITPTGVSLGRTGLIRCETAAVPAPVFEWYKGEKKLTNGQRGIR---IQNYNTRSILTVSN 287

  Fly   394 VDIQDFGAYRCVAKNSLGDTDGAIKLYHI--PQTTTMTTMAPTVSINTVPVVLVKYNKEQRYGSS 456
            |..:.||.|.|||.|.||.::.::.|..|  |.||:..|.:...|:             :.|  :
 Frog   288 VTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPSTTSPVTSSAKYSV-------------KHY--A 337

  Fly   457 QNSNTNPYNFNPGNSQ 472
            ::|:..|:...|..:|
 Frog   338 RSSSDKPHYAAPSTAQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 29/94 (31%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 2/3 (67%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig 232..324 CDD:472250 32/91 (35%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 1/2 (50%)
Ig_3 327..408 CDD:464046 21/80 (26%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 28/93 (30%)
Ig strand B 57..61 CDD:409353 2/3 (67%)
Ig strand C 70..73 CDD:409353 1/2 (50%)
Ig strand E 102..106 CDD:409353 1/3 (33%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
Ig 146..222 CDD:472250 29/83 (35%)
Ig strand B 157..161 CDD:409301 2/3 (67%)
Ig strand C 170..174 CDD:409301 1/3 (33%)
Ig strand E 187..191 CDD:409301 1/3 (33%)
Ig strand F 201..206 CDD:409301 2/4 (50%)
Ig strand G 215..218 CDD:409301 1/2 (50%)
Ig_3 226..302 CDD:464046 21/79 (27%)

Return to query results.
Submit another query.