DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and ncam1

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:XP_017951446.2 Gene:ncam1 / 100038291 XenbaseID:XB-GENE-923171 Length:1119 Species:Xenopus tropicalis


Alignment Length:425 Identity:101/425 - (23%)
Similarity:169/425 - (39%) Gaps:95/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTIL--TIQNHVITKNHRMSITH 189
            |:.|...|.::      ..:||:.|.|.:.....|.|.......||  .::..|::.|:      
 Frog   141 KNAPTPQEFIE------GEDAVIICDVSSSIPSIITWRHRGKDVILKKDVRFVVLSNNY------ 193

  Fly   190 AEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYLD----VVVPPDILDYPTSTDMVIREGSN 250
                   |:||.||::|:|.|.|: .....:.::.|.|    |.|||.:.......:.......:
 Frog   194 -------LQIRGVKKTDEGTYRCE-GRILARGEINYKDIHVIVNVPPTVQARQIRVNATANMDES 250

  Fly   251 VTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYN--GSFLTIAKVNRLNMGAYLCIASN--G 311
            |.|.|.|.|.|.|.|:|.::|.   |:.:|.|.:::|  .|.:||.:|.:.:...|.|||:|  |
 Frog   251 VVLSCDADGFPDPEISWLKKGE---PIEDGEEKISFNEDKSEMTIYRVGKDDEAEYSCIANNKAG 312

  Fly   312 IPPTVSKRVMLIVHFPPMI-WIQNQLVGAALTQNITLECQSEAYPKSINYW------MKNDTIIV 369
            ....:   ::|.|:..|.| :::|:.  |.....|||.|::...|.....|      :.::...:
 Frog   313 EAEAI---ILLKVYAKPKITYVENKT--AVELDEITLTCEASGDPIPSISWRTATRNISSEEKTL 372

  Fly   370 PGERFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPT 434
            .|...|.|.....     .||:.::...|.|.|.|:|.|::|:...|  :|...|      .||.
 Frog   373 DGHIVVKEHIRMS-----ALTLKDIQYTDAGEYICIASNAIGEDMRA--MYFEVQ------YAPK 424

  Fly   435 VSINTVPVVLVKYNKEQRYGSSQNSNTNPYNFN--------------------PGNSQQNTKLQR 479
            :.   .|||:..:            ..||.|..                    |.::..|.|:..
 Frog   425 IK---GPVVVYTW------------EGNPVNITCEVLAYPSAVVSWFRDGQLLPSSNFSNIKIYS 474

  Fly   480 GKSNSKGSDQSPSGLNNVFVGATSSLWNSQDHHSS 514
            |.|:| ..:.:|...|: |.....:..||..|.||
 Frog   475 GPSSS-SLEVNPDSEND-FGNYNCTAVNSIGHESS 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 22/98 (22%)
Ig strand B 147..151 CDD:409353 2/3 (67%)
Ig strand C 160..164 CDD:409353 1/3 (33%)
Ig strand E 195..199 CDD:409353 1/3 (33%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 26/95 (27%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 20/87 (23%)
ncam1XP_017951446.2 Ig 43..136 CDD:472250
Ig strand B 60..64 CDD:409451
Ig strand C 72..76 CDD:409451
Ig strand E 99..103 CDD:409451
Ig strand F 113..118 CDD:409451
Ig strand G 127..130 CDD:409451
IG_like 144..210 CDD:214653 20/84 (24%)
Ig strand B 155..159 CDD:409353 2/3 (67%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 193..196 CDD:409353 1/15 (7%)
Ig strand F 206..211 CDD:409353 2/5 (40%)
IgI_3_NCAM-1 231..325 CDD:143207 28/99 (28%)
Ig strand A 231..236 CDD:143207 2/4 (50%)
Ig strand A' 240..246 CDD:143207 0/5 (0%)
Ig strand B 249..259 CDD:143207 4/9 (44%)
Ig strand C 263..269 CDD:143207 3/5 (60%)
Ig strand C' 271..273 CDD:143207 1/4 (25%)
Ig strand D 280..283 CDD:143207 0/2 (0%)
Ig strand E 288..294 CDD:143207 3/5 (60%)
Ig strand F 300..309 CDD:143207 4/8 (50%)
Ig strand G 312..324 CDD:143207 3/14 (21%)
Ig 324..419 CDD:472250 24/103 (23%)
Ig strand B 342..346 CDD:409353 3/3 (100%)
Ig strand C 355..359 CDD:409353 0/3 (0%)
Ig strand E 385..389 CDD:409353 1/8 (13%)
Ig strand F 399..404 CDD:409353 2/4 (50%)
Ig strand G 412..415 CDD:409353 1/4 (25%)
IG_like 428..511 CDD:214653 20/94 (21%)
Ig strand B 439..443 CDD:409353 1/3 (33%)
Ig strand C 452..456 CDD:409353 0/3 (0%)
Ig strand E 479..483 CDD:409353 1/4 (25%)
Ig strand F 493..498 CDD:409353 0/4 (0%)
FN3 517..612 CDD:238020
FN3 624..709 CDD:238020
Herpes_BLLF1 <776..>1116 CDD:282904
PRK12323 <918..1075 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.