DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-theta and pigrl2.3

DIOPT Version :10

Sequence 1:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster
Sequence 2:NP_001077347.1 Gene:pigrl2.3 / 100003983 ZFINID:ZDB-GENE-150409-2 Length:244 Species:Danio rerio


Alignment Length:251 Identity:51/251 - (20%)
Similarity:91/251 - (36%) Gaps:61/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SQVGYLDV----VVPPDILDYPTSTDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGA 281
            :::.||.|    ::..:..|..:|..:.::.|.:||:.|......|....|.....|.....|..
Zfish     7 AKILYLSVGFWLILGAESYDAFSSNRLTVKPGGSVTIPCYYDEKNTQLKYWYSVNDECNTYTNTT 71

  Fly   282 EAVAYNGSFL----------TIAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQL 336
            |.   |.|.:          |:..:...:.|.|.|   ..:|..|..::.|.|...|.:.:::..
Zfish    72 EE---NLSVIDHPDQSLVTVTMRNLQEKHTGEYHC---GVVPGGVIYKIYLQVQDVPDVSVKSSS 130

  Fly   337 VGAALTQNITLEC-QSEAYPKSINYW----------------MKNDTIIVPGERFVPETFESGYK 384
            |......|::::| .|..|......|                .||.::.:..:.      ||.:.
Zfish   131 VSGHEGGNVSVQCFYSSGYRDKQKRWCRFKDEKCFREKKTNTSKNSSVQISDDG------ESSFT 189

  Fly   385 ITMR-LTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINT 439
            :.|. ||     :.|.|.|.|.|...:           :|...|:|| :.:||:||
Zfish   190 VLMTGLT-----LSDSGWYYCSAGEQI-----------LPLQLTVTT-SESVSVNT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 3/12 (25%)
Ig strand B 147..151 CDD:409353
Ig strand C 160..164 CDD:409353
Ig strand E 195..199 CDD:409353
Ig strand F 209..214 CDD:409353
Ig strand G 221..224 CDD:409353 0/2 (0%)
Ig 232..324 CDD:472250 20/101 (20%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 0/3 (0%)
Ig strand E 289..293 CDD:409275 1/13 (8%)
Ig strand F 303..308 CDD:409275 2/4 (50%)
Ig strand G 317..320 CDD:409275 0/2 (0%)
Ig_3 327..408 CDD:464046 19/98 (19%)
pigrl2.3NP_001077347.1 Ig 33..105 CDD:472250 15/77 (19%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 54..58 CDD:409353 0/3 (0%)
Ig strand E 86..90 CDD:409353 0/3 (0%)
Ig strand F 100..105 CDD:409353 2/7 (29%)
Ig 133..209 CDD:472250 17/86 (20%)
Ig strand B 139..143 CDD:409353 0/3 (0%)
Ig strand C 153..157 CDD:409353 0/3 (0%)
Ig strand E 188..192 CDD:409353 0/3 (0%)
Ig strand F 202..207 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.