DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and VTCN1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011540445.2 Gene:VTCN1 / 79679 HGNCID:28873 Length:332 Species:Homo sapiens


Alignment Length:206 Identity:42/206 - (20%)
Similarity:81/206 - (39%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VGRDAFLTCVVQ---DLGPYKVAWLR----------VDTQTILTIQNHVITKN-----QRIGIAN 102
            :|.|..|:|..:   .|....:.||:          .:.:..|:.|:.:....     .::.:.|
Human    98 IGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGN 162

  Fly   103 SEHKTWTMRIKDIKESDKGWYMCQINTDPMKS------QMGYLDVVVPPDI-LDYPTSTDMVVRE 160
            :     ::|:|:::.:|.|.|.|.|.|...|.      :.|...:   |:: :||..|::     
Human   163 A-----SLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSM---PEVNVDYNASSE----- 214

  Fly   161 GSNVTLKC-AATGSPEPTITWRRE----------SGVPIELATGEEVMSIEGTDLVIPNVRRHHM 214
                ||:| |....|:||:.|..:          |....||.:....|.:..   |:.||..:: 
Human   215 ----TLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVS---VLYNVTINN- 271

  Fly   215 GAYLCIASNGV 225
             .|.|:..|.:
Human   272 -TYSCMIENDI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 20/108 (19%)
IG_like 51..137 CDD:214653 19/104 (18%)
IG_like 153..237 CDD:214653 19/84 (23%)
Ig 161..224 CDD:299845 17/73 (23%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
VTCN1XP_011540445.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.