DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Negr1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_038958934.1 Gene:Negr1 / 59318 RGDID:708416 Length:362 Species:Rattus norvegicus


Alignment Length:337 Identity:106/337 - (31%)
Similarity:154/337 - (45%) Gaps:48/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALSVILLLILMSQ-QCYP--QRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKV 74
            |..:..|..:|:|. .|.|  |.|:.|         .:.:.||....|..|.|.|.::| |..|.
  Rat     9 CCSNQWLAAVLLSLCSCLPAGQSVDFP---------WAAVDNMLVRKGDTAVLRCYLED-GASKG 63

  Fly    75 AWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTD--PMKSQMG 137
            |||  :..:|:.......:.:.|:.|:....:.::::|:::..:|.|.|.|.:.|.  |...|: 
  Rat    64 AWL--NRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQV- 125

  Fly   138 YLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRR--ESGVPIELATGEEVMSIE 200
            :|.|.|||.|  |..|.||.:.||:||||.|.|||.|||.|:||.  .|..|.|          .
  Rat   126 HLTVQVPPKI--YDISNDMTINEGTNVTLTCLATGKPEPAISWRHISPSAKPFE----------N 178

  Fly   201 GTDLVIPNVRRHHMGAYLCIASNGVP-PSVSKRITLVVHFPPMITVQNQLIGAV-EGKGVTLDCE 263
            |..|.|..:.|...|.|.|.|.|.|. |.| |::.:||:|.|  |:|....|.| .|:...:.||
  Rat   179 GQYLDIYGITRDQAGEYECSAENDVSFPDV-KKVRVVVNFAP--TIQEIKSGTVTPGRSGLIRCE 240

  Fly   264 SEAYPKSINYWTRERGEIVPPGGKYSANVTE---IGGYRNSMRLHINPLTQAEFGSYRCVAKNSL 325
            ....|.....|.:        |.|...|..:   |..:.....|.:..:||..||:|.|||.|.|
  Rat   241 GAGVPPPAFEWYK--------GEKRLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKL 297

  Fly   326 GDTDGTIKLYRI 337
            |.|:.::.|.:|
  Rat   298 GTTNASLPLNQI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 24/91 (26%)
IG_like 51..137 CDD:214653 23/87 (26%)
IG_like 153..237 CDD:214653 35/86 (41%)
Ig 161..224 CDD:299845 26/64 (41%)
IG_like 252..335 CDD:214653 23/86 (27%)
Ig 258..333 CDD:143165 21/77 (27%)
Negr1XP_038958934.1 FR1 38..55 CDD:409353 5/16 (31%)
Ig strand A' 40..46 CDD:409353 2/5 (40%)
IG_like 41..129 CDD:214653 24/91 (26%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 4/8 (50%)
Ig strand C 61..67 CDD:409353 4/7 (57%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 7/34 (21%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A' 139..144 CDD:409353 3/4 (75%)
IGc2 146..204 CDD:197706 28/67 (42%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 2/4 (50%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 2/5 (40%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig strand G 207..215 CDD:409353 2/8 (25%)
Ig_3 219..295 CDD:404760 23/85 (27%)
putative Ig strand A 219..225 CDD:409353 3/7 (43%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337205
Domainoid 1 1.000 59 1.000 Domainoid score I10374
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.