DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and DSCAML1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_011541219.1 Gene:DSCAML1 / 57453 HGNCID:14656 Length:2065 Species:Homo sapiens


Alignment Length:439 Identity:108/439 - (24%)
Similarity:169/439 - (38%) Gaps:103/439 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNH--V 91
            |..|:.|..     |.....:.|:||..|||..:.|.|.....|.:.|.:   ..:|...||  |
Human   508 YQARINVRG-----PPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYK---DALLLPDNHRQV 564

  Fly    92 ITKNQRIGIANSEHKTWTMRIKDI-KESDKGWYMCQINTDPMK--SQMGYLDVVVPPDI--LDYP 151
            :.:|            .|:::.|: |..|:|.|:|.:...|..  ||..::.|.|||.|  .::|
Human   565 VFEN------------GTLKLTDVQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLIQPFEFP 617

  Fly   152 TSTDMVVREGSNVTLKCAATGSPEP-TITWRRE-------SGVPIELATGEEVMSIEGTDLVIPN 208
            .::     .|..:.:.|..:....| .||||::       |||.||   .:|.||    .|.|.:
Human   618 PAS-----IGQLLYIPCVVSSGDMPIRITWRKDGQVIISGSGVTIE---SKEFMS----SLQISS 670

  Fly   209 VRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINY 273
            |...|.|.|.|||||.. .:||:...|:|..||...||......:.||...|:|..:.||.....
Human   671 VSLKHNGNYTCIASNAA-ATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVM 734

  Fly   274 WTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLT-----------------QAEFGSYRCVA 321
            |...:|.                  .|..:.|..|||                 :.:.|.|.|.|
Human   735 WKHAKGS------------------GNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQA 781

  Fly   322 KNSLGDTDGTIKLY---RIP------PNAV----NYVENFEARHKGKKR-----TKSSESHHPAR 368
            .|.:| ||.:..::   :||      ||..    .:.:......:|::.     .|......|.|
Human   782 SNGVG-TDISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRWEKGDTVIDPDR 845

  Fly   369 AQEHSGEDMENPGKRKADLSL-GAESIDSIYGNSAAGSRRRQDLGGVLL 416
            ...::....:|..:..:.|.| .|:..||::.:..|.:...:|.|.:.|
Human   846 VMRYAIATKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGLIQL 894

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 25/94 (27%)
IG_like 51..137 CDD:214653 25/90 (28%)
IG_like 153..237 CDD:214653 29/91 (32%)
Ig 161..224 CDD:299845 25/70 (36%)
IG_like 252..335 CDD:214653 21/99 (21%)
Ig 258..333 CDD:143165 19/91 (21%)
DSCAML1XP_011541219.1 IG_like 43..119 CDD:214653
IGc2 43..110 CDD:197706
Ig 125..218 CDD:299845
IG_like 137..209 CDD:214653
I-set 245..323 CDD:254352
IGc2 252..313 CDD:197706
IGc2 340..401 CDD:197706
I-set 420..514 CDD:254352 2/5 (40%)
Ig 420..510 CDD:299845 1/1 (100%)
IGc2 531..589 CDD:197706 19/72 (26%)
IG_like 619..698 CDD:214653 29/91 (32%)
Ig 627..693 CDD:143165 27/73 (37%)
I-set 702..797 CDD:254352 24/113 (21%)
Ig7_DSCAM 719..797 CDD:143211 19/96 (20%)
I-set 803..896 CDD:254352 16/92 (17%)
Ig 815..903 CDD:299845 14/80 (18%)
FN3 899..993 CDD:238020
FN3 1000..1097 CDD:238020
fn3 1105..1191 CDD:278470
FN3 1203..1294 CDD:238020
IGc2 1318..1382 CDD:197706
FN3 1396..1486 CDD:238020
FN3 1500..1572 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.