DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and paplna

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:229 Identity:66/229 - (28%)
Similarity:97/229 - (42%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI-GIANSEHKTWTM 110
            ||:|.  |..|:.|.|.|.|          |.|.....:||  |.....|.: .:.:|:|...|:
Zfish   952 SPLVE--ARAGQTAKLQCSV----------LPVSAIHAVTI--HWSRAGQPLNSLRHSQHSDGTL 1002

  Fly   111 RIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPE 175
            .||.:...|.|.|.|.: ||..|.:...:.:.|..|:.......|:.|.:||...|.|..||. .
Zfish  1003 VIKQLTADDSGLYTCTV-TDAQKFEERQVQLRVLGDLRITKAPIDVDVVQGSTAQLACVVTGE-N 1065

  Fly   176 PTITWRRESGVPIELATGEEV-MSIEGTDLVIPNVRRHHMGAYLCIASNG-VPPSVSKRITLVVH 238
            ..:.|.| :|||:. ..|..| :|.:|| |::.||:....|.|.|.|..| :..|.:..|.|.. 
Zfish  1066 VNVGWSR-NGVPVR-PDGHRVHVSADGT-LILNNVQSVDEGTYTCNAYTGTLSVSAAAEIRLAK- 1126

  Fly   239 FPPMITVQNQLIGAVEGKGVTLDCESEAYPKSIN 272
                 |.|..:.|   |:..:.||..:  |:..|
Zfish  1127 -----TPQQDIDG---GQFSSSDCVDQ--PELAN 1150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 24/90 (27%)
IG_like 51..137 CDD:214653 24/86 (28%)
IG_like 153..237 CDD:214653 29/85 (34%)
Ig 161..224 CDD:299845 23/63 (37%)
IG_like 252..335 CDD:214653 5/21 (24%)
Ig 258..333 CDD:143165 4/15 (27%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449
IGc2 960..1022 CDD:197706 21/74 (28%)
I-set 1039..1121 CDD:333254 27/85 (32%)
PLAC 1142..1173 CDD:312271 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.