DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Cadm1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001297770.1 Gene:Cadm1 / 54725 MGIID:1889272 Length:474 Species:Mus musculus


Alignment Length:314 Identity:79/314 - (25%)
Similarity:124/314 - (39%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDI 115
            ::|...|..|.::|.|.......:..|..:.|||. .::....|:.|..:.|.......:.:.::
Mouse    54 DVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIY-FRDFRPLKDSRFQLLNFSSSELKVSLTNV 117

  Fly   116 KESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGS-PEPTIT 179
            ..||:|.|.||:.|||.:.....:.|:|||..|......|..| ||..:.:.|.|..| |..||.
Mouse   118 SISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAV-EGEEIEVNCTAMASKPATTIR 181

  Fly   180 W---RRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVP-------PSVSKRIT 234
            |   .:|.....|:....::.::  |..::..|.:.         .:|||       |:|:..:.
Mouse   182 WFKGNKELKGKSEVEEWSDMYTV--TSQLMLKVHKE---------DDGVPVICQVEHPAVTGNLQ 235

  Fly   235 ----LVVHFPPMITVQ--NQLIGAV-EGKGVTLDCESEAYPKSINY-WTRERGEIVPPGGKYSAN 291
                |.|.:.|.:.:|  ..|.|.. ||....|.||:...|:.:.. |.|...| :|.....|  
Mouse   236 TQRYLEVQYKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDE-MPQHAVLS-- 297

  Fly   292 VTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY------RIPP 339
                     ...|.||.|.:.:.|:|||.|.|.:|.......||      .|||
Mouse   298 ---------GPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 21/89 (24%)
IG_like 51..137 CDD:214653 21/85 (25%)
IG_like 153..237 CDD:214653 21/98 (21%)
Ig 161..224 CDD:299845 12/66 (18%)
IG_like 252..335 CDD:214653 22/84 (26%)
Ig 258..333 CDD:143165 20/75 (27%)
Cadm1NP_001297770.1 Ig1_Necl-2 49..143 CDD:143289 21/89 (24%)
Ig2_Necl-2 164..245 CDD:143291 18/91 (20%)
IG_like 255..333 CDD:214653 25/89 (28%)
4.1m 427..445 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.