| Sequence 1: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
| Alignment Length: | 198 | Identity: | 55/198 - (27%) |
|---|---|---|---|
| Similarity: | 85/198 - (42%) | Gaps: | 25/198 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 NMTAPVGRDAFLTCVVQDLGPY-----KVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWT 109
Fly 110 MRIKDIKESDKGWYMCQINTDP-MKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGS 173
Fly 174 PEPT--ITWRRES----------GVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVP 226
Fly 227 PSV 229 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 27/96 (28%) |
| IG_like | 51..137 | CDD:214653 | 26/92 (28%) | ||
| IG_like | 153..237 | CDD:214653 | 24/89 (27%) | ||
| Ig | 161..224 | CDD:299845 | 19/74 (26%) | ||
| IG_like | 252..335 | CDD:214653 | |||
| Ig | 258..333 | CDD:143165 | |||
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 27/96 (28%) |
| Ig_3 | 193..271 | CDD:404760 | 20/81 (25%) | ||
| Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 250..254 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||