DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr6

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:214 Identity:69/214 - (32%)
Similarity:100/214 - (46%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PAEVIVDPKFSSPIV------NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITK 94
            |......||:..|..      |:||.:|:.|:|:|.|::|....|:|:|.....|||:.::..|.
  Fly    61 PTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTS 125

  Fly    95 NQRI-GIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVP-PDILDYPTSTDMV 157
            :||. ...:.:.:.||::||..::.|.|.|.|||:|.|::|....|:|||| ..||..|   |:.
  Fly   126 DQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGP---DLH 187

  Fly   158 VREGSNVTLKCAATGSPEPT--ITW----------RRESGVPIELATGEEVMSIEGTDLVIPNVR 210
            |.:||.:.|.|....||||.  |.|          ....||.:....|:...|.    |:|.|..
  Fly   188 VDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSF----LLIQNAD 248

  Fly   211 RHHMGAYLCIASNGVPPSV 229
            ....|.|.|..||....||
  Fly   249 LADSGKYSCAPSNADVASV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 32/90 (36%)
IG_like 51..137 CDD:214653 31/86 (36%)
IG_like 153..237 CDD:214653 26/89 (29%)
Ig 161..224 CDD:299845 21/74 (28%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr6NP_001287018.1 V-set 79..174 CDD:284989 32/94 (34%)
IG_like 80..175 CDD:214653 33/94 (35%)
IG_like 184..271 CDD:214653 27/91 (30%)
IGc2 191..262 CDD:197706 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.