DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr15

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:163 Identity:43/163 - (26%)
Similarity:75/163 - (46%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI-GIANSEHKTWTMRIKDIKESDK 120
            |..|:|.|.|:.|....::|||:....|||:.......:||. .:.:...:.|:::||.::..|:
  Fly   204 GTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDE 268

  Fly   121 GWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMV------VREGSNVTLKCAATGSPEPTI- 178
            |.|.||::|:|..|.:.:|.:|.|        .|:::      |:.||.|.|:|..:.:.||.: 
  Fly   269 GTYECQVSTEPKASAIVHLRIV
EP--------KTELIGESTRHVKAGSQVKLRCIISQALEPPLF 325

  Fly   179 ----------------TWRRE---SGVPIELAT 192
                            .||.|   ..:|.|:.|
  Fly   326 INWFYNQKQIYLHNRRGWRTEIERIDLPAEVPT 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/84 (31%)
IG_like 51..137 CDD:214653 25/80 (31%)
IG_like 153..237 CDD:214653 15/66 (23%)
Ig 161..224 CDD:299845 13/52 (25%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/84 (31%)
V-set 204..290 CDD:284989 26/85 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.