DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr16

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:99/264 - (37%) Gaps:78/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQN------------- 89
            |::...:.|.|.:|.|...|:.|:|.|.:.......::|:|:..:.|:.:.:             
  Fly   194 ELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLL 258

  Fly    90 -----------------------------HVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMC 125
                                         |.:...|..|  ||...:||::||.:...|.|||.|
  Fly   259 QSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERG--NSSSLSWTLQIKYVNLEDAGWYEC 321

  Fly   126 QINTDPMKSQMGYLDVVVPPDILDYPTSTDMV------VREGSNVTLKCAATG---SPEPTITWR 181
            |:.|:|..|....|.|:.|        .|:::      |:.||.|.|.|...|   :|:....:|
  Fly   322 QLATEPKMSAKVQLFVITP--------RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR 378

  Fly   182 RESGVPIE-LATGEEV-------MSIEGT---------DLVIPNVRRHHMGAYLCIASNGVPPSV 229
            .:..|..| .|:|.:.       .:|.|:         .||||.||:.|.|.|.|...|....|:
  Fly   379 GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASM 443

  Fly   230 SKRI 233
            ...:
  Fly   444 QLHV 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 28/131 (21%)
IG_like 51..137 CDD:214653 27/127 (21%)
IG_like 153..237 CDD:214653 28/107 (26%)
Ig 161..224 CDD:299845 24/82 (29%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 28/133 (21%)
Ig <298..338 CDD:299845 16/39 (41%)
IG_like 352..447 CDD:214653 27/94 (29%)
Ig 358..439 CDD:143165 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.