DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr16

DIOPT Version :10

Sequence 1:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:264 Identity:61/264 - (23%)
Similarity:99/264 - (37%) Gaps:78/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQN------------- 89
            |::...:.|.|.:|.|...|:.|:|.|.:.......::|:|:..:.|:.:.:             
  Fly   194 ELLPRRQLSLPPLNATVQAGQHAYLPCKLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARFASLL 258

  Fly    90 -----------------------------HVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMC 125
                                         |.:...|..|  ||...:||::||.:...|.|||.|
  Fly   259 QSTTLTTLVSGGALSTTATPVAALGNSFAHAVPGGQERG--NSSSLSWTLQIKYVNLEDAGWYEC 321

  Fly   126 QINTDPMKSQMGYLDVVVPPDILDYPTSTDMV------VREGSNVTLKCAATG---SPEPTITWR 181
            |:.|:|..|....|.|:.|        .|:::      |:.||.|.|.|...|   :|:....:|
  Fly   322 QLATEPKMSAKVQLFVITP--------RTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYR 378

  Fly   182 RESGVPIE-LATGEEV-------MSIEGT---------DLVIPNVRRHHMGAYLCIASNGVPPSV 229
            .:..|..| .|:|.:.       .:|.|:         .||||.||:.|.|.|.|...|....|:
  Fly   379 GDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASM 443

  Fly   230 SKRI 233
            ...:
  Fly   444 QLHV 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 27/127 (21%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 108..112 CDD:409353 2/3 (67%)
Ig strand F 122..127 CDD:409353 3/4 (75%)
Ig strand G 134..137 CDD:409353 1/2 (50%)
IgI_1_MuSK 145..237 CDD:409562 28/115 (24%)
Ig strand A 145..148 CDD:409562 0/2 (0%)
Ig strand A' 153..158 CDD:409562 1/10 (10%)
Ig strand B 164..171 CDD:409562 3/6 (50%)
Ig strand C 177..182 CDD:409562 0/4 (0%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/9 (0%)
Ig strand E 202..208 CDD:409562 3/14 (21%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 0/5 (0%)
IG_like 252..335 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 271..282 CDD:409353
Ig strand E 301..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
dpr16NP_001287169.1 IG_like 352..447 CDD:214653 27/94 (29%)
Ig strand B 358..362 CDD:409353 2/3 (67%)
Ig strand C 373..377 CDD:409353 0/3 (0%)
Ig strand E 416..420 CDD:409353 1/3 (33%)
Ig strand F 430..435 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.