DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and LSAMP

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:373 Identity:113/373 - (30%)
Similarity:167/373 - (44%) Gaps:77/373 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MSQQCYPQRVEVPAEVI--------------VDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKV 74
            |.::..|.|.::|..::              ||  |:....|:|...|..|.|.|||:|... ||
Human     1 MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVD--FNRGTDNITVRQGDTAILRCVVEDKNS-KV 62

  Fly    75 AWLRVDTQTILTIQNHVITKNQRIGIANSEHKTW----------------TMRIKDIKESDKGWY 123
            |||                  .|.||..:.|..|                ::||:.:...|:|.|
Human    63 AWL------------------NRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSY 109

  Fly   124 MCQINT--DPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGV 186
            .|.:.|  :|..||: ||.|.|||.|.:  .|:|:.|.|||||||.|.|.|.|||.||||..:..
Human   110 TCSVQTQHEPKTSQV-YLIVQVPPKISN--ISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPT 171

  Fly   187 PIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIG 251
            ..|....||.:.|.|       :.|...|.|.|.|:|.|..:..|::.:.|::||.|| :::...
Human   172 GREFEGEEEYLEILG-------ITREQSGKYECKAANEVSSADVKQVKVTVNYPPTIT-ESKSNE 228

  Fly   252 AVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGS 316
            |..|:..:|.||:.|.|.....|.|:...|      .|||..||........|.:..:|:..:|:
Human   229 ATTGRQASLKCEASAVPAPDFEWYRDDTRI------NSANGLEIKSTEGQSSLTVTNVTEEHYGN 287

  Fly   317 YRCVAKNSLGDTDGTIKLY-RIPPNAVNYVE------NFEARHKGKKR 357
            |.|||.|.||.|:.::.|: |:.|...:.::      :|:.:..|..|
Human   288 YTCVAANKLGVTNASLVLFKRVLPTIPHPIQEIGTTVHFKQKGPGSVR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 31/107 (29%)
IG_like 51..137 CDD:214653 29/103 (28%)
IG_like 153..237 CDD:214653 33/83 (40%)
Ig 161..224 CDD:299845 26/62 (42%)
IG_like 252..335 CDD:214653 26/82 (32%)
Ig 258..333 CDD:143165 24/74 (32%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 31/109 (28%)
Ig 132..215 CDD:386229 35/91 (38%)
Ig_3 219..294 CDD:372822 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143416
Domainoid 1 1.000 59 1.000 Domainoid score I10656
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4481
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.