DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and CG7166

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:300 Identity:97/300 - (32%)
Similarity:146/300 - (48%) Gaps:34/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKT 107
            |||.|........||....|.|.||:||.:.:.|.:  ..::||..:..||::||..|...    
  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWRK--GSSVLTAGHLKITRDQRFKIVGD---- 97

  Fly   108 WTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATG 172
            :.::|..:|..|.|.|:||:.....:.|:..::::|||.:...|.:..:..|:||.|||:|.|:|
  Fly    98 YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASG 162

  Fly   173 SPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVV 237
            :|.|||.|.::     ::.:|...:| :.:.|::.||.|||.|.|.|.|.|||...||..|.|.:
  Fly   163 NPVPTIFWFKK-----DVFSGPTHLS-DSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTI 221

  Fly   238 HFPPMITVQNQLIGAVEGKGVTLDC------ESEA--YPKSINYWTRERGEIVPPGGKYSANVTE 294
            ..||.|||:...:.|.||..|.|.|      .||.  |..|......:|..:.|...:||     
  Fly   222 LSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYS----- 281

  Fly   295 IGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL 334
                     |.|......:||:|.|||.|:||.|...|::
  Fly   282 ---------LIIRNFQPTDFGNYSCVADNALGRTKKYIEV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 24/89 (27%)
IG_like 51..137 CDD:214653 24/85 (28%)
IG_like 153..237 CDD:214653 33/83 (40%)
Ig 161..224 CDD:299845 25/62 (40%)
IG_like 252..335 CDD:214653 27/90 (30%)
Ig 258..333 CDD:143165 23/82 (28%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 24/88 (27%)
Ig 56..116 CDD:143165 19/65 (29%)
IG_like 144..221 CDD:214653 33/82 (40%)
IGc2 151..209 CDD:197706 26/63 (41%)
IG_like 232..313 CDD:214653 27/94 (29%)
Ig 242..311 CDD:143165 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.