DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr13

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:201 Identity:56/201 - (27%)
Similarity:94/201 - (46%) Gaps:29/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEH-KTWTMRIKDI 115
            :|..:|..|.:.|.|..:|...|:|:|.....:||:.....:.::|....:.:| :.||::||.:
  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249

  Fly   116 KESDKGWYMCQINTDPMKSQMGYLDVVV-------PPDILDYPTSTDMVVREGSNVTLKCAATGS 173
            :..|.|.|.||::|.|..|...:|.||.       ||  :.|.|       .||.:.|:|....:
  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVV
EARAEITGPP--IRYLT-------PGSTLRLQCRVVQN 305

  Fly   174 PEPT--ITWRRESG-VPIELATGEEVMS---IEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKR 232
            .|.:  |.|..::. :..::..|..|.:   .:.::|.|...||.|.|.:.|:|||..|.||   
  Fly   306 TEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASV--- 367

  Fly   233 ITLVVH 238
               :||
  Fly   368 ---LVH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/89 (29%)
IG_like 51..137 CDD:214653 25/85 (29%)
IG_like 153..237 CDD:214653 22/89 (25%)
Ig 161..224 CDD:299845 18/68 (26%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr13NP_001033956.2 V-set 180..276 CDD:284989 26/90 (29%)
IG_like 182..262 CDD:214653 22/76 (29%)
IG_like 285..362 CDD:214653 22/85 (26%)
IGc2 292..361 CDD:197706 17/68 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.