DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and robo1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:376 Identity:93/376 - (24%)
Similarity:143/376 - (38%) Gaps:94/376 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLILMS---------QQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKV 74
            |||:|::         |...|:.:|.|.:::|  |.:.|           |.|.|.|:......:
  Fly    36 LLLVLVASNGLPAVRGQYQSPRIIEHPTDLVV--KKNEP-----------ATLNCKVEGKPEPTI 87

  Fly    75 AWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKD-----------IKESDKGWYMCQIN 128
            .|.: |.:.:.|                :|.|:..::.||           .||.|.|.|.|   
  Fly    88 EWFK-DGEPVST----------------NEKKSHRVQFKDGALFFYRTMQGKKEQDGGEYWC--- 132

  Fly   129 TDPMKSQMGY-------LDVVVPPDILDYPTS-TDMVVREGSNVTLKCA-ATGSPEPTITWRRES 184
              ..|:::|.       |.:.|..|  |:... .|..|.:|....|:|. ..|.||||:.|.:: 
  Fly   133 --VAKNRVGQAVSRHASLQIAVLRD--DFRVEPKDTRVAKGETALLECGPPKGIPEPTLIWIKD- 192

  Fly   185 GVPIE------LATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPP-- 241
            |||::      ......|..::|.:|:|.||.....|.|.|||.|.|....|....|:|...|  
  Fly   193 GVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQVKPYF 257

  Fly   242 MITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHI 306
            |...::|::  :.|:..|..|.....|.....|.:|.|.|         .|:......:...|.|
  Fly   258 MKEPKDQVM--LYGQTATFHCSVGGDPPPKVLWKKEEGNI---------PVSRARILHDEKSLEI 311

  Fly   307 NPLTQAEFGSYRCVAKNSLGDTDGTIKL-YRIPPNAVNYVENFEARHKGKK 356
            :.:|..:.|:|.|.|.|::|.......| ...||       ||..|...||
  Fly   312 SNITPTDEGTYVCEAHNNVGQISARASLIVHAPP-------NFTKRPSNKK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 20/107 (19%)
IG_like 51..137 CDD:214653 18/96 (19%)
IG_like 153..237 CDD:214653 29/91 (32%)
Ig 161..224 CDD:299845 23/69 (33%)
IG_like 252..335 CDD:214653 19/83 (23%)
Ig 258..333 CDD:143165 17/74 (23%)
robo1NP_476899.1 Ig 56..151 CDD:299845 26/129 (20%)
I-set 56..150 CDD:254352 26/128 (20%)
I-set 157..251 CDD:254352 29/94 (31%)
Ig2_Robo 159..251 CDD:143201 29/92 (32%)
I-set 255..341 CDD:254352 22/96 (23%)
Ig3_Robo 272..341 CDD:143202 18/77 (23%)
IG_like 351..436 CDD:214653 2/5 (40%)
Ig 362..444 CDD:299845
I-set 445..531 CDD:254352
IGc2 459..521 CDD:197706
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.