DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and CG13506

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:318 Identity:65/318 - (20%)
Similarity:120/318 - (37%) Gaps:52/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIA 101
            ||....|.|....:.:.|..|.|..|.|..::                ..:.|.|:....||.||
  Fly    64 AEQEAPPYFDVTDLRVEAKPGDDVILNCDARN----------------FQLSNAVVWYKNRIIIA 112

  Fly   102 NSEHK---------TWTMRIKDIKESDKGWYMCQINTDPMKSQMGY-----LDVVVPP-DILDYP 151
            |.::.         ..::.::::...|...|.|:|....::.....     |.::... ||    
  Fly   113 NGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDI---- 173

  Fly   152 TSTDMVVREGSNVTLKCAATGSPEPTITWRRE--SGVPIELATGEEVMSIEGTDLVIPNVRRHHM 214
            |......|:|.:..|:|........||.|...  :|.|..:.....|       :::.||...:.
  Fly   174 TDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGV-------IILDNVDEKNA 231

  Fly   215 GAYLCIASNGV--PPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRE 277
            |.|.|:|.:|.  ||..:..|.  |.:.|:::.....:...:|....|.|...|.|...:|:.::
  Fly   232 GDYQCLADDGSRHPPHGTVHID--VQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKD 294

  Fly   278 RGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY 335
             |:.:....|||.. ..:....|...|.:..:|.::.|.|.|..:|::|..:  :|::
  Fly   295 -GKTLQLSDKYSLK-DSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 17/103 (17%)
IG_like 51..137 CDD:214653 16/94 (17%)
IG_like 153..237 CDD:214653 20/87 (23%)
Ig 161..224 CDD:299845 15/64 (23%)
IG_like 252..335 CDD:214653 19/82 (23%)
Ig 258..333 CDD:143165 17/74 (23%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 14/82 (17%)
IGc2 83..146 CDD:197706 13/78 (17%)
IG_like 176..254 CDD:214653 20/86 (23%)
Ig 176..239 CDD:299845 15/69 (22%)
I-set 258..349 CDD:254352 20/95 (21%)
Ig 275..348 CDD:143165 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.