DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and CG13506

DIOPT Version :10

Sequence 1:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:318 Identity:65/318 - (20%)
Similarity:120/318 - (37%) Gaps:52/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIA 101
            ||....|.|....:.:.|..|.|..|.|..::                ..:.|.|:....||.||
  Fly    64 AEQEAPPYFDVTDLRVEAKPGDDVILNCDARN----------------FQLSNAVVWYKNRIIIA 112

  Fly   102 NSEHK---------TWTMRIKDIKESDKGWYMCQINTDPMKSQMGY-----LDVVVPP-DILDYP 151
            |.::.         ..::.::::...|...|.|:|....::.....     |.::... ||    
  Fly   113 NGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDI---- 173

  Fly   152 TSTDMVVREGSNVTLKCAATGSPEPTITWRRE--SGVPIELATGEEVMSIEGTDLVIPNVRRHHM 214
            |......|:|.:..|:|........||.|...  :|.|..:.....|       :::.||...:.
  Fly   174 TDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGV-------IILDNVDEKNA 231

  Fly   215 GAYLCIASNGV--PPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRE 277
            |.|.|:|.:|.  ||..:..|.  |.:.|:::.....:...:|....|.|...|.|...:|:.::
  Fly   232 GDYQCLADDGSRHPPHGTVHID--VQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKD 294

  Fly   278 RGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY 335
             |:.:....|||.. ..:....|...|.:..:|.::.|.|.|..:|::|..:  :|::
  Fly   295 -GKTLQLSDKYSLK-DSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE--VKVH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 16/94 (17%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 0/3 (0%)
Ig strand E 108..112 CDD:409353 0/3 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
IgI_1_MuSK 145..237 CDD:409562 23/96 (24%)
Ig strand A 145..148 CDD:409562 1/3 (33%)
Ig strand A' 153..158 CDD:409562 0/4 (0%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 3/4 (75%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 0/5 (0%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 1/7 (14%)
IG_like 252..335 CDD:214653 19/82 (23%)
Ig strand B 258..262 CDD:409353 1/3 (33%)
Ig strand C 271..282 CDD:409353 2/10 (20%)
Ig strand E 301..306 CDD:409353 1/4 (25%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 0/2 (0%)
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 16/92 (17%)
Ig_3 173..238 CDD:464046 17/75 (23%)
Ig 258..349 CDD:472250 20/95 (21%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 1/3 (33%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.