DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and wrapper

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:390 Identity:89/390 - (22%)
Similarity:152/390 - (38%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CRKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPY 72
            |....|.|:.::|..:.::..:...:|      ...||.|....:.........|.|.:..  |:
  Fly     6 CSVVRCLLAALILGQVQAELDFNNDLE------NSQKFKSIPTTVKTYENDTVQLPCTLNT--PF 62

  Fly    73 K-VAWLRVDTQTILTIQNHVITKNQRIGIANSEH---------KTW---TMRIKDIKESDKGWYM 124
            : |.|.|.|                 :.:.:|.|         ..|   ::::.:::.||.|.|.
  Fly    63 RYVRWHRDD-----------------VALVDSRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYY 110

  Fly   125 CQINTDP-MKSQMGYLDVVVPPDILDYPTS-TDMVVREGSNVTLKCAATGSPEPTITWRRESGV- 186
            |::|:|. ...|...::|.:.|.:|..|:. |:.  |.|:...:.|.|.|.|:|.||||....| 
  Fly   111 CEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQ--RIGAIFEVVCEAQGVPQPVITWRLNGNVI 173

  Fly   187 -PIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLI 250
             | :..||..      ..|::....|:..|...|:|||||.......:.|.|.|.|.:::...::
  Fly   174 QP-QSNTGNR------QSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSIPQPVV 231

  Fly   251 GAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTE------IGGYRNSMR--LHIN 307
            ....|....|:|..||.|.:...|. ..|..|..|...:.:.:|      :..|.|::|  |.:.
  Fly   232 YTKLGSRAHLECIVEAAPAATVKWF-HHGLPVALGAHSTTHESELQTNRSVDHYVNAVRHMLVVK 295

  Fly   308 PLTQAEFGSYRCVAKNSLGDTDGTIK--------LYRIPPNAVNYVENFEARHKGKKRTKSSESH 364
            .:..|:.|.|.|.|.|.:....|:::        |::|.|.                 |:||.||
  Fly   296 SVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPG-----------------TQSSTSH 343

  Fly   365  364
              Fly   344  343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 18/103 (17%)
IG_like 51..137 CDD:214653 18/99 (18%)
IG_like 153..237 CDD:214653 26/86 (30%)
Ig 161..224 CDD:299845 20/64 (31%)
IG_like 252..335 CDD:214653 22/98 (22%)
Ig 258..333 CDD:143165 21/82 (26%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 18/101 (18%)
IG_like 41..118 CDD:214653 17/95 (18%)
IG_like 145..218 CDD:214653 25/79 (32%)
Ig 147..219 CDD:299845 24/78 (31%)
I-set 224..323 CDD:254352 22/99 (22%)
IGc2 236..314 CDD:197706 21/78 (27%)
FN3 339..431 CDD:238020 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.