DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and fipi

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:118/264 - (44%) Gaps:35/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EHK-------TWTMRIK----DIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMV 157
            |||       |.|.::|    .|..:|||.:.|:.....:.|:.  .|::|...|.....:|.|.
  Fly    67 EHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKS--FDLIV
YQKITFTENATVMT 129

  Fly   158 VREGSNVTLKCAATGSPEPTITWRRESGVPIEL-ATGEEVMSIEGTDLVIPNVRRHHMGAYLCIA 221
            |:||...|:.|...|.|:|.:|| ..:|.||.. |..:....|....|:|..|.::..|.|.|.|
  Fly   130 VKEGEKATILCEVKGEPQPNVTW-HFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRA 193

  Fly   222 --SNGVPPSVSKRITL--VVHFP-----PMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRE 277
              .|.:...:.:|..|  :.|.|     |.::::...|...    .||.||:.|.|.:...|.|:
  Fly   194 YQVNSIASD
MQERTVLMKIEHKPIWSKTPFVSLKYAYINGT----ATLMCEALAEPPANFTWYRK 254

  Fly   278 RGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLYR--IPPN 340
            ..::......|:   .:...|.:|:.:|:  |..:.|.:|||.|:|.||..:.|.:|.:  .||:
  Fly   255 HNKLHSNNRLYT---IQSDSYWSSLTIHV--LNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPS 314

  Fly   341 AVNY 344
            ..|:
  Fly   315 PANF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 12/47 (26%)
IG_like 51..137 CDD:214653 12/43 (28%)
IG_like 153..237 CDD:214653 27/88 (31%)
Ig 161..224 CDD:299845 20/65 (31%)
IG_like 252..335 CDD:214653 22/82 (27%)
Ig 258..333 CDD:143165 22/74 (30%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/49 (27%)
I-set 128..202 CDD:254352 24/74 (32%)
Ig 133..>193 CDD:299845 19/60 (32%)
IG_like 228..307 CDD:214653 23/87 (26%)
Ig 235..305 CDD:143165 22/74 (30%)
FN3 312..415 CDD:238020 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.