DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr8

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:227 Identity:70/227 - (30%)
Similarity:105/227 - (46%) Gaps:18/227 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVPAEVIVDPKFSSPI-VNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQR 97
            ::|......|.|.:.| .|:|..||:...|||.|::||...|:|:|.....:||:..:..|.:||
  Fly    33 DLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQR 97

  Fly    98 IGIANSEH-KTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVP-PDILDYPTSTDMVVRE 160
            ....:|.| :.||:||:..:..|.|.|.|||:|.|......||::|.| .||:..|   ::.:..
  Fly    98 FEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGP---ELHINR 159

  Fly   161 GSNVTLKCAATGSPE--PTITWRRESGV--------PIELATGEEVMSIEGTDLVIPNVRRHHMG 215
            ||.:.|.|....:||  ||:.|.....:        .|.|.|.:.|::.  :.|::........|
  Fly   160 GSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTT--SRLLVQKAITQDSG 222

  Fly   216 AYLCIASNGVPPSVSKRITLVVHFPPMITVQN 247
            .|.|..||..|.||...|....|...|.|..|
  Fly   223 LYTCTPSNANPTSVRVHIVDGEHPAAMHTGNN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 34/90 (38%)
IG_like 51..137 CDD:214653 32/86 (37%)
IG_like 153..237 CDD:214653 23/93 (25%)
Ig 161..224 CDD:299845 18/72 (25%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 30/79 (38%)
V-set 52..143 CDD:284989 33/90 (37%)
IG_like 153..238 CDD:214653 23/89 (26%)
ig 153..232 CDD:278476 20/83 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.